DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and colt

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:306 Identity:68/306 - (22%)
Similarity:121/306 - (39%) Gaps:35/306 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNS--- 77
            ||..|........|||.:|:|.|....|....: ..|||...........||:||:::|.::   
  Fly    22 GGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQ-PLYRGTFDCAAKTIKNEGVRGLYKGMSAPLT 85

  Fly    78 --GQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQMV 140
              ..:.::.:|........|.|....:..|    |  ..|:.|..:|....:...|.:.::..:.
  Fly    86 GVAPIFAMCFAGYALGKRLQQRGEDAKLTY----P--QIFVAGSFSGLFSTLIMAPGERIKVLLQ 144

  Fly   141 AADPSSRRSQMNTFTGLR-KVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPP 204
            .........:.|...... |:||..|...:.:|...|:::..|..|..||.|:.|..   :||..
  Fly   145 TQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQD---VAKSK 206

  Fly   205 DQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILGCITTTF 269
            .:..:|..|.....|.::|:...::..|||:||.|:|            ..|| .|....|.:.|
  Fly   207 SETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQ------------SAPE-GTYKHGIRSVF 258

  Fly   270 RE----EGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHY--IAP 309
            ::    :|....|:|:.|.:|:|...:|..|...::..:.:  :||
  Fly   259 KDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANKFFNIVAP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 63/290 (22%)
Mito_carr 23..99 CDD:278578 18/80 (23%)
Mito_carr 108..194 CDD:278578 17/86 (20%)
Mito_carr 216..307 CDD:278578 22/96 (23%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 20/85 (24%)
Mito_carr 112..202 CDD:395101 19/98 (19%)
Mito_carr 210..299 CDD:395101 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.