DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and Ucp4A

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:307 Identity:71/307 - (23%)
Similarity:126/307 - (41%) Gaps:42/307 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IAGAATRTITQPLDVLKIRFQMQVEPVTNHKGS---KYRGVIHAFKSVYAEEGMRGMFRGHNSGQ 79
            :|.:.....|.|||:.|.|.|:|.|...:..|.   :|||::.....:..|||...:::|.....
  Fly    49 VAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPAL 113

  Fly    80 VLSISYALVQFWSYEQLRSMAHQ-----FDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQM 139
            ...:.|:.|:..||:.:|....|     ...|:..      :||..||.:....|.|.|:|:.|:
  Fly   114 YRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSA------LCGVTAGAVAQWLASPADLVKVQI 172

  Fly   140 -------VAADPSSRRSQMNTFTGLRKVYKMEGWMGLSRG-LP----FTLVQVFPLVGANFLFYK 192
                   :..:|....|..:.|   |::.:..|..||.:| :|    ..||.:..|...:.:.:.
  Fly   173 QMEGRRRLMGEPPRVHSAGHAF---RQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHL 234

  Fly   193 YLNAAVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPE 257
            .:|..        |..:.|...: |....:|.:|.::..|||::|.||    ..|.....||...
  Fly   235 IMNRL--------QMPDCHTVHV-LASVCAGFVAAIMGTPADVVKTRI----MNQPTDENGRGLL 286

  Fly   258 CPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKR 304
            ....:.|:..|..:||....|||.||..::....|..::..::..::
  Fly   287 YRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 70/300 (23%)
Mito_carr 23..99 CDD:278578 22/78 (28%)
Mito_carr 108..194 CDD:278578 21/97 (22%)
Mito_carr 216..307 CDD:278578 22/89 (25%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 71/307 (23%)
Mito_carr 39..138 CDD:278578 24/88 (27%)
Mito_carr 142..239 CDD:278578 23/105 (22%)
Mito_carr 248..336 CDD:278578 22/91 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.