DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and slc25a16

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_991112.1 Gene:slc25a16 / 324578 ZFINID:ZDB-GENE-030131-3299 Length:321 Species:Danio rerio


Alignment Length:317 Identity:75/317 - (23%)
Similarity:139/317 - (43%) Gaps:48/317 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRG 74
            |.....||:||...::...|||.:||..|.|      :...|:.||....|:|..:||..|:::|
Zfish    26 LRSFTAGGVAGCCAKSTIAPLDRVKILLQAQ------NPHYKHLGVFATLKAVPKKEGFLGLYKG 84

  Fly    75 HNSGQVLSISYALVQFWSYEQLRSMAHQ---FDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVR 136
            :.:..:....|..:||.:::..:...|.   ......|     .:.|.:||....:...|.||:|
Zfish    85 NGAMMIRIFPYGAIQFMAFDNYKKFLHTKVGISGHVHR-----LMAGSMAGMTAVICTYPLDVIR 144

  Fly   137 TQMVAADPSSRRSQMNTFTGLR----KVYKMEGWM-GLSRGLPFTLVQVFPLVGANFLFYKYLNA 196
            .::........|     ::|:|    .:|..||.: |..|||..|::.:.|..|.:|..:..|..
Zfish   145 ARLAFQVTGHHR-----YSGIRHAFQTIYHKEGGISGFYRGLIPTIIGMAPYAGFSFFTFGTLKT 204

  Fly   197 AVL------MAKP----PD---QRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQE 248
            ..|      :.||    ||   .:.:::    .|.|.::|.:|:.|.||.|:.::|:||.|    
Zfish   205 LGLTHFPEQLGKPSLDNPDVLVLKTQVN----LLCGGVAGAIAQTISYPLDVARRRMQLGA---- 261

  Fly   249 RKTFGRNPECPTILGCITTTFREEGI-GGFYKGMLPTLLKAGLMSAVYFSIYDMFKR 304
              :...:.:|.::...:...:.:.|: .|.|:|:....::.....||.|:.|:..|:
Zfish   262 --SLPDHDKCCSLTKTLKHVYSQYGVKKGLYRGLSLNYIRCVPSQAVAFTTYEFMKQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 69/302 (23%)
Mito_carr 23..99 CDD:278578 19/75 (25%)
Mito_carr 108..194 CDD:278578 22/90 (24%)
Mito_carr 216..307 CDD:278578 22/90 (24%)
slc25a16NP_991112.1 Mito_carr 21..113 CDD:278578 25/92 (27%)
PTZ00169 25..319 CDD:240302 75/317 (24%)
Mito_carr 120..205 CDD:278578 23/94 (24%)
Mito_carr 227..319 CDD:278578 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.