DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and Ant2

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:308 Identity:72/308 - (23%)
Similarity:133/308 - (43%) Gaps:30/308 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRG 74
            ||..:.||::.|..:|...|::.:|:..|:|..........:|:|::..|..:..|:|....:||
  Fly    19 LMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRG 83

  Fly    75 HNSGQVL------SISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFD 133
             |...|:      ::::|....:....|..:.....:||.  |......||.||........|.|
  Fly    84 -NLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRH--FAGNLASGGAAGATSLCFVYPLD 145

  Fly   134 VVRTQMVAADPSSRRSQMNTFTG----LRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYL 194
            ..||:: |||..  :.....|.|    |.||.|.:|.:||.||...::..:.....|.|.||.  
  Fly   146 FARTRL-AADVG--KGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYD-- 205

  Fly   195 NAAVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMA-FKQERKTFGRNPEC 258
            .....:..|......:..|...:...::|:.:    ||.|.:::|:.:.: .|:....:.....|
  Fly   206 TCRDFLPNPKSTPFYVSWAIAQVVTTVAGIAS----YPFDTVRRRMMMQSGLKKSEMVYKNTAHC 266

  Fly   259 PTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHY 306
            ..::.      ::||||.|:||.|..::: |...|:..::||..|:::
  Fly   267 WLVIA------KQEGIGAFFKGALSNIIR-GTGGALVLALYDEMKKYF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 66/291 (23%)
Mito_carr 23..99 CDD:278578 16/81 (20%)
Mito_carr 108..194 CDD:278578 27/89 (30%)
Mito_carr 216..307 CDD:278578 20/92 (22%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 71/304 (23%)
Mito_carr 17..111 CDD:278578 20/92 (22%)
Mito_carr 119..215 CDD:278578 29/102 (28%)
Mito_carr 218..307 CDD:278578 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.