DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and sesB

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:317 Identity:78/317 - (24%)
Similarity:141/317 - (44%) Gaps:51/317 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVG-------GGIAGAATRTITQPLDVLKIRFQM-----QVEPVTNHKGSKYRGVIHAFKSVYAE 65
            |||       |||:.|.::|...|::.:|:..|:     |:.|     ..:|:|::..|..:..|
  Fly    20 AVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISP-----DKQYKGMVDCFIRIPKE 79

  Fly    66 EGMRGMFRGHNSGQVL------SISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCL 124
            :|....:|| |...|:      ::::|....:....|..:.....:||.  |......||.||..
  Fly    80 QGFSSFWRG-NLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRY--FAGNLASGGAAGAT 141

  Fly   125 GAVAAQPFDVVRTQMVAADPSSRRSQMNTFTG----LRKVYKMEGWMGLSRGLPFTLVQVFPLVG 185
            ......|.|..||:: |||  :.:.....|||    |.|::|.:|.:||.||...::..:.....
  Fly   142 SLCFVYPLDFARTRL-AAD--TGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRA 203

  Fly   186 ANFLFYKYLNAAVLMAKPPDQRQEIHGAFLFLNGALSGV---LAKMIVYPADLLKKRIQLMAFKQ 247
            |.|.||......:     ||.:    ...::::.|::.|   :|.::.||.|.:::|:.:.:.::
  Fly   204 AYFGFYDTARGML-----PDPK----NTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRK 259

  Fly   248 ERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKR 304
            ..:...:|     .|.|..|..::||.|.|:||....:|: |...|....:||..|:
  Fly   260 ATEVIYKN-----TLHCWATIAKQEGTGAFFKGAFSNILR-GTGGAFVLVLYDEIKK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 70/298 (23%)
Mito_carr 23..99 CDD:278578 17/86 (20%)
Mito_carr 108..194 CDD:278578 27/89 (30%)
Mito_carr 216..307 CDD:278578 23/92 (25%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 23/101 (23%)
PTZ00169 23..312 CDD:240302 75/314 (24%)
Mito_carr 124..220 CDD:278578 31/105 (30%)
Mito_carr 223..312 CDD:278578 23/94 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.