DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and RGD1561206

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_038956923.1 Gene:RGD1561206 / 308678 RGDID:1561206 Length:321 Species:Rattus norvegicus


Alignment Length:295 Identity:101/295 - (34%)
Similarity:158/295 - (53%) Gaps:9/295 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QLMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPV-TNHKGSKYRGVIHAFKSVYAEEGMRGMF 72
            :|..||.|.::|..||.:..||||:|||||:|:|.| .:...:||.|:..|.|.:..|||.|..:
  Rat    23 KLEVAVAGSVSGFVTRALISPLDVIKIRFQLQLERVCPSDPDAKYHGIFQAAKQIIQEEGPRAFW 87

  Fly    73 RGHNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRT 137
            :||...|:|||.|..|||.::|:|..:.:|.:.::...|...|:|||::.....:...|.||:||
  Rat    88 KGHVPAQILSIGYGAVQFLAFEELTVLLYQANLYQTHQFSAHFVCGGLSAGTATLTVHPVDVLRT 152

  Fly   138 QMVAADPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAK 202
            ::.|....:.|..:.|      :|:.||.....:||..|::.:||..|..|. |:.|........
  Rat   153 RLAAQGEPNLREAIIT------MYRTEGPFVFYKGLTPTVIAIFPYAGLQFC-YRSLKRTYDWVM 210

  Fly   203 PPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILGCITT 267
            |||::|..:...| |.|..|||::|.:.||.||.|..:|:..|:..|..||:......:|.....
  Rat   211 PPDRKQTGNLKNL-LCGCGSGVISKTLTYPLDLFKNHLQVRGFEYARSAFGQVRSYRGLLDLARQ 274

  Fly   268 TFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMF 302
            ..:.|...||:||:.|:|:||.|.:...|..|::|
  Rat   275 VLQHEDTRGFFKGLSPSLMKAALSTGFMFFWYELF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 96/281 (34%)
Mito_carr 23..99 CDD:278578 35/76 (46%)
Mito_carr 108..194 CDD:278578 24/85 (28%)
Mito_carr 216..307 CDD:278578 30/87 (34%)
RGD1561206XP_038956923.1 Mito_carr 24..111 CDD:395101 39/86 (45%)
Mito_carr 126..206 CDD:395101 25/86 (29%)
Mito_carr 215..314 CDD:395101 32/96 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24089
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.