DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and SPBC1604.04

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_596636.2 Gene:SPBC1604.04 / 2540155 PomBaseID:SPBC1604.04 Length:283 Species:Schizosaccharomyces pombe


Alignment Length:294 Identity:78/294 - (26%)
Similarity:131/294 - (44%) Gaps:52/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGGGIAGAATRTITQPLDVLKIRFQM---QVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGH 75
            :.|||:....|.:..|.||:|||.|:   .:.||              ||....:||:|.::||:
pombe    21 LAGGISSVICRFMIAPFDVIKIRMQITQSSLRPV--------------FKETVQKEGVRALWRGN 71

  Fly    76 NSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQMV 140
            ...::|.:.|...:|.::.:|:   |..:........:.|:||..||....:.:.|.|.:||:. 
pombe    72 VVAELLYLVYGAAEFVAFSKLK---HLTENLAMNDHAVNFLCGTSAGIFATLTSYPLDTMRTKF- 132

  Fly   141 AADPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPD 205
                :|.....:.....:|:|...|..|...||.|:::|:.|..|..|:||:   |:..:..|  
pombe   133 ----ASYAKTPHMLPATKKIYAEAGIKGFFPGLKFSVIQIGPYAGCFFMFYR---ASEAVLSP-- 188

  Fly   206 QRQEIHGAFLFLNGALSGVLA----KMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILGCIT 266
                   ..|.|:..||||:|    |.|::|.|.:.|.:|  .|....|:|         ..|..
pombe   189 -------LGLALSSTLSGVIAGAGSKAIMFPVDTVVKTLQ--TFPSNYKSF---------KDCFL 235

  Fly   267 TTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYD 300
            :.:|..||.|.|:|:..::||.....|:...||:
pombe   236 SIYRNSGIKGLYRGLSVSMLKVAPGRAITMLIYE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 75/285 (26%)
Mito_carr 23..99 CDD:278578 21/78 (27%)
Mito_carr 108..194 CDD:278578 23/85 (27%)
Mito_carr 216..307 CDD:278578 27/89 (30%)
SPBC1604.04NP_596636.2 Mito_carr 15..95 CDD:278578 24/90 (27%)
PTZ00169 21..276 CDD:240302 78/294 (27%)
Mito_carr 105..179 CDD:278578 21/78 (27%)
Mito_carr 192..277 CDD:278578 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I3296
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1438
OMA 1 1.010 - - QHG55227
OrthoFinder 1 1.000 - - FOG0001923
OrthoInspector 1 1.000 - - otm47319
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24089
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
88.020

Return to query results.
Submit another query.