DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and Slc25a43

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001078966.1 Gene:Slc25a43 / 194744 MGIID:2684854 Length:341 Species:Mus musculus


Alignment Length:316 Identity:66/316 - (20%)
Similarity:136/316 - (43%) Gaps:65/316 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNSGQVL 81
            |:|||.:.::|.||::..:  ..||..|.:|.    .|:....:.|:..||.|.:::|:....:.
Mouse    20 GLAGAFSLSLTAPLELATV--LAQVGKVQSHS----LGLWATGRRVWLSEGPRALWKGNGVACLR 78

  Fly    82 SISYALVQFWSYEQLRSMAHQFDYWRERPFLMFF-------------ICGGIAGCLGAVAAQPFD 133
            ....::||..:|               |.|::.|             :.|.:||.:..:...|.|
Mouse    79 LFPCSMVQLAAY---------------RKFVVLFMDDLGRISQWSSIVTGSLAGMVSTIVTYPTD 128

  Fly   134 VVRTQMVAAD--PSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNA 196
            :::|:::..:  ..|.|..::.|:   .:|:.||::.|.||:..|::...|....:.|.  |:|.
Mouse   129 LIKTRLMVQNVLEPSYRGLIHAFS---TIYQQEGFLALYRGVSLTVLGAVPFSAGSLLV--YMNL 188

  Fly   197 AVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTI 261
            ..:...|.|:...:..   |.|..::..:::.:.:|.|.:|:::|           .::|..|..
Mouse   189 EKVWNGPRDRFSHLQN---FANVCVAAAVSQTLSFPFDTVKRKMQ-----------AQSPYLPHY 239

  Fly   262 LG----------CITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHYI 307
            .|          |.....:.:|:.|.:.|:...|||......|.||:::..||.::
Mouse   240 GGVDVHFSGAADCFRQIVKTQGVLGLWNGLTANLLKVVPYFGVMFSMFEFCKRIFL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 60/305 (20%)
Mito_carr 23..99 CDD:278578 16/75 (21%)
Mito_carr 108..194 CDD:278578 21/100 (21%)
Mito_carr 216..307 CDD:278578 21/100 (21%)
Slc25a43NP_001078966.1 Mito_carr 8..101 CDD:278578 23/101 (23%)
Solcar 1 11..101 23/101 (23%)
Mito_carr 102..185 CDD:278578 18/87 (21%)
Solcar 2 105..185 18/84 (21%)
Mito_carr 197..295 CDD:278578 22/111 (20%)
Solcar 3 200..298 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.