DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and slc25a43

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_002934585.2 Gene:slc25a43 / 100485727 XenbaseID:XB-GENE-6258507 Length:342 Species:Xenopus tropicalis


Alignment Length:327 Identity:85/327 - (25%)
Similarity:146/327 - (44%) Gaps:73/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNSGQV 80
            |||||.|:||:|.||||:||..|:.    |.|....:.|   .||.:...||:|.:::|:.:..|
 Frog    19 GGIAGVASRTLTAPLDVVKILSQVG----TFHTKQGFAG---TFKLLCKAEGVRALWKGNLTACV 76

  Fly    81 LSISYALVQFWSYEQLRSM----AHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQMVA 141
            ....|:.||..:|.:...:    ..:...|:.      .:.||:||.:.||...|.|:|:|:::.
 Frog    77 RLFPYSAVQLAAYRRFTLLFMDDLGRISKWQA------IVSGGLAGVVAAVVIYPTDIVKTRLIV 135

  Fly   142 ADPSSRRSQMNTFTG----LRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAK 202
                 :.|...|:.|    |..:|..||:..|.||:..|::...|...:  ||:..::...:..:
 Frog   136 -----QNSLEPTYRGIIHALCSIYYQEGFRSLYRGISLTVLGAIPFSAS--LFFMNISLDRIWQE 193

  Fly   203 PPDQRQEIHGAFL-----FLNGALSGVLAKMIVYPADLLKKRIQLMA-FKQERKTFGRNPECPTI 261
            |        |..|     |.||.|:..:|:.:.:|.:.:|:::|..: |.         |.|..:
 Frog   194 P--------GVCLSPLQHFANGCLAAAVAQTMSFPFETVKRKMQAQSQFL---------PHCGGV 241

  Fly   262 -------LGCITTTFREEGIGGFYKGMLPTLLKA----GLMSAVYFSIYDMFKR-------HYIA 308
                   |.|.....:.:|:...:.|:...:||.    |||    ||.|:..||       :.|:
 Frog   242 DVHFNGMLNCFRQIVKTKGVLSLWNGLTANILKVVPYFGLM----FSTYECCKRFCLYQNGYIIS 302

  Fly   309 PM 310
            |:
 Frog   303 PL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 75/305 (25%)
Mito_carr 23..99 CDD:278578 24/75 (32%)
Mito_carr 108..194 CDD:278578 24/89 (27%)
Mito_carr 216..307 CDD:278578 25/109 (23%)
slc25a43XP_002934585.2 PTZ00169 17..274 CDD:240302 73/291 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.