DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NaCP60E and Catsper4

DIOPT Version :9

Sequence 1:NP_001261172.1 Gene:NaCP60E / 37981 FlyBaseID:FBgn0085434 Length:2896 Species:Drosophila melanogaster
Sequence 2:NP_808534.1 Gene:Catsper4 / 329954 MGIID:3043288 Length:442 Species:Mus musculus


Alignment Length:326 Identity:83/326 - (25%)
Similarity:136/326 - (41%) Gaps:79/326 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1751 PAFEWFVLVLIFASSITLCFEDINLDKNKTLKRVLYWINFS-----FCLIFVVEMILKWLALGFS 1810
            |||:..:..|:.:::||     |.|..|..|.:..|.: ||     ...|.:.|::|.||. ||.
Mouse    68 PAFQLLLAFLLLSNAIT-----IALRTNSYLGQKHYEL-FSTIDDIVLTILICEVLLGWLN-GFW 125

  Fly  1811 KYFTSFWTILDFIIVFVSVFSLLIEENENLKVLRSLRTLRALRPLRAISRWQGMRIVVNALMYAI 1875
            .::...|.||:|.|||:......|::.:.:.:...||.||.:....|:   :.:..::..::.::
Mouse   126 IFWKDGWNILNFAIVFILFMGFFIKQLDMVAITYPLRVLRLVHVCMAV---EPLARIIKVILQSM 187

  Fly  1876 PSIFNVLLVCLVFWLIFSIMGVQFFGGKFFKCVNEMGELLPITEVNDKWDCIEQNYTWINSKITF 1940
            |.:.||:.:.|.|.|:||:.||..||....|                                .|
Mouse   188 PDLANVMALILFFMLVFSVFGVTLFGAFVPK--------------------------------HF 220

  Fly  1941 DHVGMGYLALLQVATFEGWMEVMADAVDARGVDLQPQREANLYAY-----IYFVIFIVCGSFFTL 2000
            .::|:....|....|.:||:::..|.          |.:...||.     |||.:||..|:|..|
Mouse   221 QNMGVALYTLFICITQDGWLDIYTDF----------QMDEREYAMEVGGAIYFAVFITLGAFIGL 275

  Fly  2001 NLFIGVIIDNF-NMLKKKYEGGVLEMFLTESQK-----------HYYTAMKKLGRKKPQKVIKRP 2053
            |||:.|:..|. .|:|...|.|.|.:..||:::           |...|     ||....|.|.|
Mouse   276 NLFVVVVTTNLEQMMKTGEEEGHLNIKFTETEEDEDWTDELPLVHCTEA-----RKDTSTVPKEP 335

  Fly  2054 I 2054
            :
Mouse   336 L 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaCP60ENP_001261172.1 Ion_trans 152..371 CDD:278921
Ion_trans 705..902 CDD:278921
Ion_trans 1768..2019 CDD:278921 65/261 (25%)
Na_channel_gate 2009..2063 CDD:240441 15/58 (26%)
Ion_trans 2085..2320 CDD:278921
GPHH 2331..2386 CDD:293510
Catsper4NP_808534.1 Ion_trans 91..289 CDD:278921 60/244 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.