DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NaCP60E and Catsper3

DIOPT Version :9

Sequence 1:NP_001261172.1 Gene:NaCP60E / 37981 FlyBaseID:FBgn0085434 Length:2896 Species:Drosophila melanogaster
Sequence 2:XP_006253634.1 Gene:Catsper3 / 290989 RGDID:1305700 Length:395 Species:Rattus norvegicus


Alignment Length:316 Identity:79/316 - (25%)
Similarity:142/316 - (44%) Gaps:58/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  2029 ESQKHYYTAMKKLGRKKPQKVIKRPINHFLAMFYDLSNSRRFEIAIFVLIFLN--MLTMGIEHYD 2091
            :|...:.||...|..|..|  .||......|.|..::.|..|:|.:...:..|  :|.:| .:||
  Rat    13 KSSSLFGTASVALHAKLSQ--YKRRDKQCQAFFRKVTKSTLFQILMITTVTANSFLLVLG-TNYD 74

  Fly  2092 QPHAVFFILEVSNAFFTTVFGLEAIVKIVGLRYHYFTVPWNVFD-FLLVLASIFGILMEDIMIDL 2155
            ....:|.:.|:|..||.:::..|.::|:......|:...:|:.| .:||:.:|            
  Rat    75 IHFRMFRVFEISELFFVSIYACEFLMKVYVDPITYWKDGYNILDVVILVIITI------------ 127

  Fly  2156 PISPTLLRVVR-------VFRIG----RILRLIKAAKGIRKLLFALVVSLPALFNIGALLGLITF 2209
               |..||.::       .|..|    |:|:||..::|||.|:.|:..::..:.::..||.|:.|
  Rat   128 ---PYFLRKIKGNHFEYLHFADGIQSLRVLKLISYSRGIRTLIIAVGETVYTVASVLTLLFLLMF 189

  Fly  2210 IYAILGMSLFGNVKLQGALDDMVNFQTFGRSMQLLFRLMTSAGWNDVLESLMIQPPDCDPFIHGH 2274
            ::||||..||||.. :|   |:.|:.....:...||.|.|..||.::.|.|     |...|    
  Rat   190 VFAILGFCLFGNAD-RG---DLTNWGNLAAAFFTLFSLATVDGWTNLQEEL-----DKRKF---- 241

  Fly  2275 TNGNCGHPLLAITYFTSFIIISYMIVINMYIAIILENFNQAHQEEEIGIVEDDLEM 2330
                    .::..:...||:::..|.:||::.:::     .|.|:.|...|.::.:
  Rat   242 --------TVSRAFTILFILLASFIFLNMFVGVMI-----MHTEDSIKKFEREMTL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaCP60ENP_001261172.1 Ion_trans 152..371 CDD:278921
Ion_trans 705..902 CDD:278921
Ion_trans 1768..2019 CDD:278921
Na_channel_gate 2009..2063 CDD:240441 10/33 (30%)
Ion_trans 2085..2320 CDD:278921 62/246 (25%)
GPHH 2331..2386 CDD:293510 79/316 (25%)
Catsper3XP_006253634.1 Ion_trans 73..269 CDD:278921 59/236 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.