DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NaCP60E and TPCN2

DIOPT Version :10

Sequence 1:NP_001261172.1 Gene:NaCP60E / 37981 FlyBaseID:FBgn0085434 Length:2896 Species:Drosophila melanogaster
Sequence 2:NP_620714.2 Gene:TPCN2 / 219931 HGNCID:20820 Length:752 Species:Homo sapiens


Alignment Length:165 Identity:33/165 - (20%)
Similarity:63/165 - (38%) Gaps:45/165 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 INETENSS----QYVLAWKRDIAVLTAGNVKVTVNPRIRLMP---------VQAHTDPHGSLS-- 102
            :|:|..::    :.:..|::.   ||..|...|||..::::.         ::...|.|...|  
Human   393 VNQTHYTNLINDETIAVWRQK---LTEHNNANTVNGVVQILSSAACWNGSFLEKKIDEHFKTSPK 454

  Fly   103 ------------------TGYNLEIRDVRNSDAGDYICQIGSMEPKEIVHTLEI-LVPPKIDYIS 148
                              :.:::.:..:.||.....|.|:.|..|.  |..:.| |:.|:...:.
Human   455 IPGIDLNSTRILFEKLMHSQHSMILEQILNSFESCLIPQLSSSPPD--VEAMRIYLILPEFPLLQ 517

  Fly   149 PSNKMDIHKGAPIRME-CRASGNPTPKIV---WSR 179
            .| |..|....|:.|. .|...||: |::   ||:
Human   518 DS-KYYITLTIPLAMAILRLETNPS-KVLDNWWSQ 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaCP60ENP_001261172.1 Ion_trans 125..371 CDD:459842 17/60 (28%)
Ion_trans 687..902 CDD:459842
Ion_trans 1751..2019 CDD:459842
Na_channel_gate 2009..2063 CDD:240441
Ion_trans 2067..2320 CDD:459842
GPHH 2332..2378 CDD:465306
TPCN2NP_620714.2 Ion_trans <184..315 CDD:459842
Interaction with phosphatidylinositol 3,5-bisphosphate. /evidence=ECO:0000269|PubMed:30860481 203..207
Ion_trans 431..697 CDD:459842 24/124 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.