DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NaCP60E and F17C8.6

DIOPT Version :9

Sequence 1:NP_001261172.1 Gene:NaCP60E / 37981 FlyBaseID:FBgn0085434 Length:2896 Species:Drosophila melanogaster
Sequence 2:NP_497974.1 Gene:F17C8.6 / 175626 WormBaseID:WBGene00008911 Length:279 Species:Caenorhabditis elegans


Alignment Length:302 Identity:63/302 - (20%)
Similarity:113/302 - (37%) Gaps:99/302 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1156 DNSSRRYGSEEHDEAFLKY-----------------QKSLLTRSPSY--RKSLDRLSQSSGQSQR 1201
            :|.|..|.|||  :|.|.|                 ::|:..|...:  |....|| :.:.:|..
 Worm     2 ENFSLLYSSEE--DALLSYADIRNFQLVWNMVDIEQKRSIPVRRVKFLLRLLKGRL-EVNDESDG 63

  Fly  1202 SLLKSEEAEMRRHSSGQS------LNSMSIEQDELLSQQGNLREELLNCDQKELFQFLQEEEELQ 1260
            .|.|....||.|..:|..      ||.:|....::  ::....||||   |:|..::: .|||:.
 Worm    64 LLFKHMCHEMERLHNGDDVSFHDVLNMLSYRSVDI--RKSLQLEELL---QREELEYI-IEEEVA 122

  Fly  1261 KGTKLRRISNVMRSRRPSSQMGQPENETMVEHSEFDNIIQSFEKELEEIKRSTTSLERKLSNLSE 1325
            |.|....:.|.:::.:..      :|.|:.:.|...:.. :|.:..|.:.:...        |:|
 Worm   123 KHTIRAWLENCLKNIKAK------QNNTLGKMSSIGSTF-AFPQSQEVLTKGVV--------LTE 172

  Fly  1326 PSPAAD--EATKAIMEHIAIITGASERSAADEVVLPLNPYDSYDLSSVPRRSQSVS---AAAQRQ 1385
            .||..|  :..|          |:.::.|                    :|..|::   |.||::
 Worm   173 ASPEEDSLQGDK----------GSGKKKA--------------------QRGNSITEIVAEAQKK 207

  Fly  1386 SVKLKRRSLEKQR---------------KIDEDFSISNEIRK 1412
            |||.....:.::|               :::||.....|||:
 Worm   208 SVKRATDKISERRGTLRQMQMGTYDELEEVEEDEDTDGEIRR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaCP60ENP_001261172.1 Ion_trans 152..371 CDD:278921
Ion_trans 705..902 CDD:278921
Ion_trans 1768..2019 CDD:278921
Na_channel_gate 2009..2063 CDD:240441
Ion_trans 2085..2320 CDD:278921
GPHH 2331..2386 CDD:293510
F17C8.6NP_497974.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.