DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ance-5 and Ace

DIOPT Version :9

Sequence 1:NP_573392.2 Gene:Ance-5 / 37980 FlyBaseID:FBgn0035076 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_997507.1 Gene:Ace / 11421 MGIID:87874 Length:1312 Species:Mus musculus


Alignment Length:618 Identity:161/618 - (26%)
Similarity:277/618 - (44%) Gaps:73/618 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DRAK--------DRMRHV---------WSLNRRIFVQLTAKGKSPLGGQVLNSKLEVEAETYRLF 81
            |.||        ||...|         |..|..|.::         |.::|..| ..|...:.|.
Mouse   650 DEAKADRFVEEYDRTAQVLLNEYAEANWQYNTNITIE---------GSKILLEK-STEVSNHTLK 704

  Fly    82 YDLAGNLSVVSVAELNDPLLRRRVQRMAKLQLQGLRPKDYEQAKDLLRQIHNFVNGPLVCPYEDC 146
            |  ........|:...:..::|.::::..|....|.||:.|:...:|..:....:...:| |.:.
Mouse   705 Y--GTRAKTFDVSNFQNSSIKRIIKKLQNLDRAVLPPKELEEYNQILLDMETTYSLSNIC-YTNG 766

  Fly   147 SARGSLAMYPQIMNKNMHTKLYEDLVINWKAWRRAINEKDVAKNTFIGYVRLLRIAATYNGHVTP 211
            :.   :.:.|.:.|....::.||:|:..||:||..:....:.  .|..||......|..||:...
Mouse   767 TC---MPLEPDLTNMMATSRKYEELLWAWKSWRDKVGRAILP--FFPKYVEFSNKIAKLNGYTDA 826

  Fly   212 SRTWYLNYDTENFQAEMEAVVWEIMPLYRELHAYLRREVQAAYPKADTKSDGAISAPIMDQILSQ 276
            ..:|...|:::|.:.::|.:..|:.|||..||||:||.:...|.......||.|.|.::..:.:|
Mouse   827 GDSWRSLYESDNLEQDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQ 891

  Fly   277 DW---------YPHQFFRTPHQGRQHQLPSVHRRLEEVLV----TPVKINRKAAEFFESLGLMVM 328
            .|         :|             ..|::.  ..|.::    ||.:|.::|..||.||||:.:
Mouse   892 TWSNIYDLVAPFP-------------SAPNID--ATEAMIKQGWTPRRIFKEADNFFTSLGLLPV 941

  Fly   329 PNIFYDRFSRRMNDEEGGAECKSQV--YYFPPDVALRYCPKLDYKKMMQIHGTMAELQYHLYKMQ 391
            |..|:::.......:.....|....  :|...|..::.|..::.:.::..|..|..:||.:....
Mouse   942 PPEFWNKSMLEKPTDGREVVCHPSAWDFYNGKDFRIKQCTSVNMEDLVIAHHEMGHIQYFMQYKD 1006

  Fly   392 LPFGLDTEPCPGFGAAIAETVILASGTPRHLHRLHILLNDSLTEEQSLNRLFRMGVHTLIAVPQY 456
            ||........|||..||.:.:.|:..||:||:.|::|..:....|..:|.|.:|.:..:..:|..
Mouse  1007 LPVTFREGANPGFHEAIGDIMALSVSTPKHLYSLNLLSTEGSGYEYDINFLMKMALDKIAFIPFS 1071

  Fly   457 FINDKFLVDVMDGRIGVKDYNCAYWGLQDKFAGVQPPLQRLNKDFDVDFKFYRGLNPETSNTKKF 521
            ::.|::...|.||.|..::||..:|.|:.|:.|:.||:.|...|||...||:...|  ....:.|
Mouse  1072 YLIDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPAN--VPYVRYF 1134

  Fly   522 LAEILGFQFYRSFCLASGQYKPGDPNFPLHNCDFYDSKEAGKKIRDMMQLGATRHWRDVMEIATG 586
            ::.|:.|||:.:.|.|:|.      ..|||.||.|.||||||.:.|.|:||.::.|.:.|::.||
Mouse  1135 VSFIIQFQFHEALCRAAGH------TGPLHKCDIYQSKEAGKLLADAMKLGYSKPWPEAMKLITG 1193

  Fly   587 ERKLSGRGILEYFAPLFTWLKERNKQLDIEPGW 619
            :..:|...::.||.||..||...|::.....||
Mouse  1194 QPNMSASAMMNYFKPLTEWLVTENRRHGETLGW 1226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ance-5NP_573392.2 GluZincin 93..610 CDD:301352 143/531 (27%)
AceNP_997507.1 Peptidase M2 1 35..635
Peptidase_M2 45..628 CDD:279709
Peptidase M2 2 636..1237 161/618 (26%)
Peptidase_M2 649..1226 CDD:279709 159/616 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000442
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10514
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.