DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ance-5 and ace

DIOPT Version :9

Sequence 1:NP_573392.2 Gene:Ance-5 / 37980 FlyBaseID:FBgn0035076 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001116882.1 Gene:ace / 100144634 XenbaseID:XB-GENE-479789 Length:1284 Species:Xenopus tropicalis


Alignment Length:602 Identity:165/602 - (27%)
Similarity:274/602 - (45%) Gaps:78/602 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 WSLNRRIFVQLTAKGKSPLGGQVLNSKLEVEAETYRLFYDL-AGNLSVVSVAELNDPLLRRRVQR 107
            |:.|..|    |...|..:    |:..|.:...|  |.|.| |.|   ...::..||..:|.:::
 Frog   660 WAYNTNI----TEANKQVM----LDKNLAMSGHT--LQYGLQARN---YDYSDFQDPETQRILRK 711

  Fly   108 MAKLQLQGL---RPKDYEQAKDLLRQIHNFVNGPLVCPYEDCSARGSLAMYP------QIMNKNM 163
            ::::....|   ..|:|.|....:..|::...   ||  :|    |:...:|      :|:.|  
 Frog   712 LSEIDKAALSEEEQKEYNQITSDMETIYSVAK---VC--KD----GNTNCHPLDPDLTEILAK-- 765

  Fly   164 HTKLYEDLVINWKAWRRA----INEKDVAKNTFIGYVRLLRIAATYNGHVTPSRTWYLNYDTENF 224
             ::.|::|:..||.||.|    |.||      :..||:|...||..||:......|...|:|...
 Frog   766 -SRDYDELLFAWKGWRDASGKQIREK------YKRYVQLANKAAQLNGYNDNGAYWRSWYETPTL 823

  Fly   225 QAEMEAVVWEIMPLYRELHAYLRREVQAAYPKADTKSDGAISAPIMDQILSQDW---------YP 280
            ::::|.:..|:.|||..||||:||.:...|........|.|.|.::..:.:|.|         ||
 Frog   824 ESDVEKLYDELQPLYLNLHAYVRRALYKKYGDKRINLKGPIPAHLLGNMWAQSWSNIYELLVPYP 888

  Fly   281 H--QFFRTPHQGRQHQLPSVHRRLEEVLVTPVKINRKAAEFFESLGLMVMPNIFYDR-FSRRMND 342
            :  |...||....::.             ||.::..::..||:||||:.||..|:|: ...:..|
 Frog   889 NAAQVDATPAMIAKNW-------------TPKRMFEESDNFFKSLGLLPMPQEFWDKSMIEKPKD 940

  Fly   343 EEGGAECKSQVYYFPPDVALRYCPKLDYKKMMQIHGTMAELQYHLYKMQLPFGLDTEPCPGFGAA 407
            .|......:..:|...|..::.|..::...::.:|..|..:||.|.....|........|||..|
 Frog   941 REVVCHASAWDFYNRKDFRIKQCTVVNMDDLITVHHEMGHVQYFLQYKDQPILFREGANPGFHEA 1005

  Fly   408 IAETVILASGTPRHLHRLHILLNDSLTEEQSLNRLFRMGVHTLIAVPQYFINDKFLVDVMDGRIG 472
            |.:.:.|:..||:||..:.:|.......|..:|.|..:.:..:..:|..|:.|::...|.|||..
 Frog  1006 IGDVLALSVSTPKHLQSIGLLDKVEDNPESDINYLMSIALDKIAFLPFGFLMDQWRWKVFDGRTP 1070

  Fly   473 VKDYNCAYWGLQDKFAGVQPPLQRLNKDFDVDFKFYRGLNPETSNTKKFLAEILGFQFYRSFCLA 537
            ..:||..:|.|:.|:.|:.||:.|...|||...||:  :.......:.|::.::.|||:.:.|.|
 Frog  1071 DSEYNQQWWNLRLKYQGLVPPVLRTENDFDPGAKFH--IPASVPYIRYFISFVIQFQFHEALCKA 1133

  Fly   538 SGQYKPGDPNFPLHNCDFYDSKEAGKKIRDMMQLGATRHWRDVMEIATGERKLSGRGILEYFAPL 602
            :.|      ..|||.||.|.|.:|||.:.|.|:||.::.|.:.|:..||:|.:|...:|:||.||
 Frog  1134 ANQ------EGPLHKCDIYQSTQAGKLLGDAMKLGNSKPWPEAMQTITGQRNMSAHALLKYFQPL 1192

  Fly   603 FTWLKERNKQLDIEPGW 619
            ..||.:.|.:.....||
 Frog  1193 TDWLIKENTKNGETLGW 1209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ance-5NP_573392.2 GluZincin 93..610 CDD:301352 149/541 (28%)
aceNP_001116882.1 Peptidase_M2 28..611 CDD:279709
Peptidase_M2 631..1209 CDD:279709 163/600 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D266227at33208
OrthoFinder 1 1.000 - - FOG0000442
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.