DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKAIN and NKAIN1

DIOPT Version :9

Sequence 1:NP_001246506.1 Gene:NKAIN / 37979 FlyBaseID:FBgn0085442 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_078798.2 Gene:NKAIN1 / 79570 HGNCID:25743 Length:207 Species:Homo sapiens


Alignment Length:214 Identity:96/214 - (44%)
Similarity:130/214 - (60%) Gaps:23/214 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSCS--CTRRHFLLSICFLQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFRVKY 63
            ||.||  ||    |::.|.||::..:|||:||||||.|||||.||.||:.:|.|.:|...:|.:|
Human     1 MGKCSGRCT----LVAFCCLQLVAALERQIFDFLGYQWAPILANFLHIMAVILGIFGTVQYRSRY 61

  Fly    64 IITYLIWNFLWIGWNTFLICFYLNVGQLNRDSDLLNLGTGSV--SWFEANGYGC--KPTYN--MA 122
            :|.|..|..||:|||.|:|||||.||||::|.|.:.....|:  ||:..||.||  .|..|  :|
Human    62 LILYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLA 126

  Fly   123 ADDTFRPQRPERVEGCLLDYPLVEITHSGVQCALALLGILGAILISCIFLDEDDRFDFMNG-DA- 185
            .:|    .....|.|||||||.:|...|.:|..|||.|.:.|..:|.:||:|:|.|||:.| |: 
Human   127 LED----HHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSY 187

  Fly   186 --KSPQ---HTVVHPMYVS 199
              ::||   |..:.|:|.|
Human   188 GYQAPQKTSHLQLQPLYTS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKAINNP_001246506.1 NKAIN 12..199 CDD:283329 89/199 (45%)
NKAIN1NP_078798.2 NKAIN 10..206 CDD:398973 89/199 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141035
Domainoid 1 1.000 178 1.000 Domainoid score I3564
eggNOG 1 0.900 - - E1_KOG4556
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001076
OrthoInspector 1 1.000 - - otm41902
orthoMCL 1 0.900 - - OOG6_106588
Panther 1 1.100 - - O PTHR13084
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X730
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.