DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKAIN and nkain1

DIOPT Version :9

Sequence 1:NP_001246506.1 Gene:NKAIN / 37979 FlyBaseID:FBgn0085442 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_001072596.1 Gene:nkain1 / 780051 XenbaseID:XB-GENE-946558 Length:207 Species:Xenopus tropicalis


Alignment Length:225 Identity:95/225 - (42%)
Similarity:122/225 - (54%) Gaps:28/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSCS--CTRRHFLLSICFLQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFRVKY 63
            ||.||  ||    |:.||.||:...::||:||||||.|||||.||.||:.:|.|..|..|:|.:|
 Frog     1 MGRCSGRCT----LVGICCLQLAAALQRQIFDFLGYQWAPILANFLHIMVVILGILGTLHYRSRY 61

  Fly    64 IITYLIWNFLWIGWNTFLICFYLNVGQLNRDSDL-LNLGTG-SVSWFEANGYGCKPTYNMAADDT 126
            :|.|.||..||:.||.|:|||||.||..::..|| :|..|. ..||:..||.||..|........
 Frog    62 LILYSIWLALWVAWNAFIICFYLEVGHFSQHRDLIMNFNTSMHRSWWMENGPGCLVTPVRGPPLP 126

  Fly   127 FRPQRPERVEGCLLDYPLVEITHSGVQCALALLGILGAILISCIFLDEDDRFDFMNGDAKSPQHT 191
            ........|.|||||||.:|...|.:|..|||.|.:.|..:|.:|:||:|.|||:..        
 Frog   127 LADHHMVTVTGCLLDYPYIEALSSALQIFLALFGFVYACYVSKVFMDEEDSFDFIGS-------- 183

  Fly   192 VVHPMYVSYTSIPTTSASATMQSNKHLQLQ 221
                 |.||      ...|.|::: |||||
 Frog   184 -----YDSY------GYQAPMKTS-HLQLQ 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKAINNP_001246506.1 NKAIN 12..199 CDD:283329 80/188 (43%)
nkain1NP_001072596.1 NKAIN 10..204 CDD:368537 89/212 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 167 1.000 Domainoid score I3797
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001076
OrthoInspector 1 1.000 - - otm49124
Panther 1 1.100 - - O PTHR13084
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X730
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.