DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKAIN and nkain3

DIOPT Version :9

Sequence 1:NP_001246506.1 Gene:NKAIN / 37979 FlyBaseID:FBgn0085442 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_001072235.1 Gene:nkain3 / 779682 XenbaseID:XB-GENE-5816251 Length:181 Species:Xenopus tropicalis


Alignment Length:180 Identity:75/180 - (41%)
Similarity:110/180 - (61%) Gaps:16/180 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CTRRHFLLSICFLQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFRVKYIITYLIW 70
            ||.|..|:.||.||::..:|||:||||||.|||||.||.||:.:|.|.:|...:|.:||:.|.||
 Frog     4 CTGRCTLIFICTLQMLVALERQIFDFLGYQWAPILGNFLHIIVVILGLFGTIQYRPRYIVAYTIW 68

  Fly    71 NFLWIGWNTFLICFYLNVGQLNRDSDLLNLGTGSV--SWFEANGYGC-------KPTYNMAADDT 126
            ...|:.||.|:|||||.||.|::|:||:.... |:  ||:..:|.||       .|:.|: .|.:
 Frog    69 TAFWVAWNVFIICFYLEVGGLSKDTDLMTFNI-SIHRSWWREHGPGCVWRLVPAPPSKNL-GDHS 131

  Fly   127 FRPQRPERVEGCLLDYPLVEITHSGVQCALALLGILGAILISCIFLDEDD 176
            |     ..|.||::::..:|:.||.||..|:|:|.:.|..:..:..||:|
 Frog   132 F-----ISVTGCIIEFQYIEVIHSAVQILLSLIGFVYACYVISVITDEED 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKAINNP_001246506.1 NKAIN 12..199 CDD:283329 72/174 (41%)
nkain3NP_001072235.1 NKAIN 10..177 CDD:310324 72/174 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 167 1.000 Domainoid score I3797
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H18265
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001076
OrthoInspector 1 1.000 - - otm49124
Panther 1 1.100 - - LDO PTHR13084
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4984
SonicParanoid 1 1.000 - - X730
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.040

Return to query results.
Submit another query.