DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKAIN and Nkain3

DIOPT Version :9

Sequence 1:NP_001246506.1 Gene:NKAIN / 37979 FlyBaseID:FBgn0085442 Length:658 Species:Drosophila melanogaster
Sequence 2:XP_038966720.1 Gene:Nkain3 / 689576 RGDID:1591051 Length:218 Species:Rattus norvegicus


Alignment Length:202 Identity:83/202 - (41%)
Similarity:124/202 - (61%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CTRRHFLLSICFLQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFRVKYIITYLIW 70
            ||.|..|:.:|.||:::.:|||:|||||:.|||||.||.||:.:|.|.:|...:|.:||:.|.:|
  Rat     4 CTGRCSLVCLCALQLLSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPRYIMVYTVW 68

  Fly    71 NFLWIGWNTFLICFYLNVGQLNRDSDLLNLGTGSV--SWFEANGYGC------KPTYNMAADDTF 127
            ..||:.||.|:|||||.||.|::|:||:.... ||  ||:..:|.||      ...::|..|.|:
  Rat    69 TALWVTWNVFIICFYLEVGGLSKDTDLMTFNI-SVHRSWWREHGPGCVRRVLPPSAHDMMDDYTY 132

  Fly   128 RPQRPERVEGCLLDYPLVEITHSGVQCALALLGILGAILISCIFLDEDDRFDFMNG-DAKS--PQ 189
                 ..|.||::|:..:|:.||.||..|:|:|.:.|..:..|.::|:|.|||:.| ||.|  ..
  Rat   133 -----VSVTGCVVDFQYLEVIHSAVQILLSLVGFVYACYVISISMEEEDTFDFIGGLDAHSHYRD 192

  Fly   190 HTVVHPM 196
            |..:.|:
  Rat   193 HVELKPV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKAINNP_001246506.1 NKAIN 12..199 CDD:283329 80/196 (41%)
Nkain3XP_038966720.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I3843
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H18265
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001076
OrthoInspector 1 1.000 - - otm46038
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13084
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X730
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.