DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKAIN and Nkain1

DIOPT Version :9

Sequence 1:NP_001246506.1 Gene:NKAIN / 37979 FlyBaseID:FBgn0085442 Length:658 Species:Drosophila melanogaster
Sequence 2:XP_006539179.1 Gene:Nkain1 / 67149 MGIID:1914399 Length:214 Species:Mus musculus


Alignment Length:212 Identity:91/212 - (42%)
Similarity:124/212 - (58%) Gaps:29/212 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLSICF-----------LQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFRVKYII 65
            |:|:|.           ||| ..::||:||||||.|||||.||.||:.:|.|.:|...:|.:|:|
Mouse     7 LVSLCLRPPVAPRCLPALQV-AALQRQIFDFLGYQWAPILANFLHIMAVILGIFGTVQYRSRYLI 70

  Fly    66 TYLIWNFLWIGWNTFLICFYLNVGQLNRDSDLLNLGTGSV--SWFEANGYGC--KPTYN--MAAD 124
            .|..|..||:|||.|:|||||.||||::|.|.:.....|:  ||:..||.||  .|..|  :|.:
Mouse    71 LYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALE 135

  Fly   125 DTFRPQRPERVEGCLLDYPLVEITHSGVQCALALLGILGAILISCIFLDEDDRFDFMNG-DA--- 185
            |    .....|.|||||||.:|...|.:|..|||.|.:.|..:|.:||:|:|.|||:.| |:   
Mouse   136 D----HHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGY 196

  Fly   186 KSPQ---HTVVHPMYVS 199
            ::||   |..:.|:|.|
Mouse   197 QAPQKTSHLQLQPLYTS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKAINNP_001246506.1 NKAIN 12..199 CDD:283329 90/210 (43%)
Nkain1XP_006539179.1 NKAIN 26..213 CDD:368537 85/191 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830988
Domainoid 1 1.000 177 1.000 Domainoid score I3569
eggNOG 1 0.900 - - E1_KOG4556
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001076
OrthoInspector 1 1.000 - - otm43949
orthoMCL 1 0.900 - - OOG6_106588
Panther 1 1.100 - - O PTHR13084
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X730
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.700

Return to query results.
Submit another query.