DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKAIN and Nkain2

DIOPT Version :9

Sequence 1:NP_001246506.1 Gene:NKAIN / 37979 FlyBaseID:FBgn0085442 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_001013429.2 Gene:Nkain2 / 432450 MGIID:1923447 Length:208 Species:Mus musculus


Alignment Length:212 Identity:90/212 - (42%)
Similarity:127/212 - (59%) Gaps:18/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSCS--CTRRHFLLSICFLQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFRVKY 63
            ||.||  ||    |:.||.:|::.::|||:||||||.|||||.||.||:.:|.|.:|...:|.:|
Mouse     1 MGYCSGRCT----LIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPRY 61

  Fly    64 IITYLIWNFLWIGWNTFLICFYLNVGQLNRDSDLLNLGTGSV--SWFEANGYGCKPTYNMAADDT 126
            :..|.:|..||:.||.|:|||||..|.|::::||:.....|:  ||:..||.||..|....|.| 
Mouse    62 VTGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCMVTSVTPAPD- 125

  Fly   127 FRPQ--RPERVEGCLLDYPLVEITHSGVQCALALLGILGAILISCIFLDEDDRFDFMNG-DA--- 185
            :.|:  |...|.||.|||..:|:.||.:|..|||.|.:.|..:.....:|:|.|||:.| |:   
Mouse   126 WAPEDHRYITVSGCFLDYQYIEVAHSSLQIVLALAGFIYACYVVRCITEEEDSFDFIGGFDSYGY 190

  Fly   186 KSPQ---HTVVHPMYVS 199
            :.||   |..:.|||:|
Mouse   191 QGPQKTSHLQLQPMYMS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKAINNP_001246506.1 NKAIN 12..199 CDD:283329 83/197 (42%)
Nkain2NP_001013429.2 NKAIN 10..207 CDD:310324 83/197 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830990
Domainoid 1 1.000 177 1.000 Domainoid score I3569
eggNOG 1 0.900 - - E1_KOG4556
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001076
OrthoInspector 1 1.000 - - otm43949
orthoMCL 1 0.900 - - OOG6_106588
Panther 1 1.100 - - O PTHR13084
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4688
SonicParanoid 1 1.000 - - X730
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.