DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKAIN and nkain1

DIOPT Version :9

Sequence 1:NP_001246506.1 Gene:NKAIN / 37979 FlyBaseID:FBgn0085442 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_956839.1 Gene:nkain1 / 393517 ZFINID:ZDB-GENE-040426-1472 Length:207 Species:Danio rerio


Alignment Length:212 Identity:88/212 - (41%)
Similarity:121/212 - (57%) Gaps:19/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSCS--CTRRHFLLSICFLQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFRVKY 63
            ||.|.  ||    |:.||.||::..::||||||:||.|||||.||.||:.:|.|.:|....|.:|
Zfish     1 MGRCDGRCT----LVVICCLQLVAALQRQVFDFMGYQWAPILANFLHIMAVILGVFGTVQVRSRY 61

  Fly    64 IITYLIWNFLWIGWNTFLICFYLNVGQLNRDSDLLNLGTGSV--SWFEANGYGCKPTYNMAADDT 126
            :|.|.:|..:|:|||:|:|||||.||.|::|.|.|.....|:  ||:..||.||..|  ...|..
Zfish    62 LILYAVWLVVWVGWNSFIICFYLEVGHLSQDRDFLMTFNTSLHRSWWMENGPGCLVT--PVPDSP 124

  Fly   127 FRPQRPE--RVEGCLLDYPLVEITHSGVQCALALLGILGAILISCIFLDEDDRFDFMNG----DA 185
            ..||...  .|.||||||..:|:..|.:|..|||.|.:.|..:|....|::|.|||.:|    :.
Zfish   125 LAPQDHHVITVSGCLLDYQYIEVVSSALQVFLALFGFVYACYVSKYSPDDEDSFDFFDGLGSYNY 189

  Fly   186 KSPQ---HTVVHPMYVS 199
            :.||   ...:.|:|.:
Zfish   190 QPPQKISQLQLRPLYTT 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKAINNP_001246506.1 NKAIN 12..199 CDD:283329 83/197 (42%)
nkain1NP_956839.1 NKAIN 10..206 CDD:283329 83/197 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573909
Domainoid 1 1.000 174 1.000 Domainoid score I3617
eggNOG 1 0.900 - - E1_KOG4556
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001076
OrthoInspector 1 1.000 - - otm24570
orthoMCL 1 0.900 - - OOG6_106588
Panther 1 1.100 - - O PTHR13084
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X730
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.700

Return to query results.
Submit another query.