DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKAIN and NKAIN3

DIOPT Version :9

Sequence 1:NP_001246506.1 Gene:NKAIN / 37979 FlyBaseID:FBgn0085442 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_001291462.1 Gene:NKAIN3 / 286183 HGNCID:26829 Length:218 Species:Homo sapiens


Alignment Length:202 Identity:82/202 - (40%)
Similarity:122/202 - (60%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CTRRHFLLSICFLQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFRVKYIITYLIW 70
            ||.|..|:.:|.||:::.:|||:|||||:.|||||.||.||:.:|.|.:|...:|.:||:.|.:|
Human     4 CTGRCSLICLCALQLVSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPRYIMVYTVW 68

  Fly    71 NFLWIGWNTFLICFYLNVGQLNRDSDLLNLGTGSV--SWFEANGYGC------KPTYNMAADDTF 127
            ..||:.||.|:|||||.||.|::|:||:.... ||  ||:..:|.||      ...:.|..|.|:
Human    69 TALWVTWNVFIICFYLEVGGLSKDTDLMTFNI-SVHRSWWREHGPGCVRRVLPPSAHGMMDDYTY 132

  Fly   128 RPQRPERVEGCLLDYPLVEITHSGVQCALALLGILGAILISCIFLDEDDRFDFMNG-DAKS--PQ 189
                 ..|.||::|:..:|:.||.||..|:|:|.:.|..:..|.::|:|.|||:.| |..|  ..
Human   133 -----VSVTGCIVDFQYLEVIHSAVQILLSLVGFVYACYVISISMEEEDTFDFIGGLDTHSYYQD 192

  Fly   190 HTVVHPM 196
            |..:.|:
Human   193 HVELKPV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKAINNP_001246506.1 NKAIN 12..199 CDD:283329 79/196 (40%)
NKAIN3NP_001291462.1 NKAIN 10..198 CDD:368537 78/193 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141036
Domainoid 1 1.000 178 1.000 Domainoid score I3564
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H18265
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001076
OrthoInspector 1 1.000 - - otm41902
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13084
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4984
SonicParanoid 1 1.000 - - X730
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.