DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKAIN and nkain2

DIOPT Version :9

Sequence 1:NP_001246506.1 Gene:NKAIN / 37979 FlyBaseID:FBgn0085442 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_001338635.1 Gene:nkain2 / 110438188 ZFINID:ZDB-GENE-041014-77 Length:208 Species:Danio rerio


Alignment Length:215 Identity:94/215 - (43%)
Similarity:130/215 - (60%) Gaps:24/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSCS--CTRRHFLLSICFLQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFRVKY 63
            ||.||  ||    |..||.:|:|:|:|||:||||||.|||||.||.||:.:|.|.:|...||.:|
Zfish     1 MGCCSGRCT----LAFICGMQLISILERQIFDFLGYQWAPILTNFIHIITVILGLFGTVQFRPRY 61

  Fly    64 IITYLIWNFLWIGWNTFLICFYLNVGQLNRDSDLLNLGTGSV--SWFEANGYGCK-----PTYNM 121
            :..|.:|..||:.||.|:|||||.||.|::|:||:.....|:  ||:..||.||:     |..:.
Zfish    62 VTGYAVWLVLWVAWNVFIICFYLEVGDLSKDTDLIMTFNISMHRSWWMENGPGCRVTPVTPPPSW 126

  Fly   122 AADDTFRPQRPERVEGCLLDYPLVEITHSGVQCALALLGILGAILISCIFLDEDDRFDFMNG-DA 185
            |.:|    .|...:.||||:|..||:.||.:|..|||.|.:.|..:..:..:|:|.|||:.| |:
Zfish   127 APED----HRYISIAGCLLEYQFVEVAHSSLQIILALAGFIYACYVVKLISEEEDSFDFIGGFDS 187

  Fly   186 ---KSPQ---HTVVHPMYVS 199
               :.||   |..:.|||:|
Zfish   188 YGYQGPQKTSHLQLQPMYMS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKAINNP_001246506.1 NKAIN 12..199 CDD:283329 87/200 (44%)
nkain2NP_001338635.1 NKAIN 10..207 CDD:310324 87/200 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573910
Domainoid 1 1.000 174 1.000 Domainoid score I3617
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001076
OrthoInspector 1 1.000 - - otm24570
orthoMCL 1 0.900 - - OOG6_106588
Panther 1 1.100 - - O PTHR13084
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X730
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.