DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKAIN and nkain4

DIOPT Version :9

Sequence 1:NP_001246506.1 Gene:NKAIN / 37979 FlyBaseID:FBgn0085442 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_001107118.1 Gene:nkain4 / 100002876 ZFINID:ZDB-GENE-080204-60 Length:208 Species:Danio rerio


Alignment Length:215 Identity:90/215 - (41%)
Similarity:124/215 - (57%) Gaps:15/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSCS--CTRRHFLLSICFLQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFRVKY 63
            ||.||  ||    |:.:|..|::..:||||||||||.|||||.||||||.:|.|.:|...:|.:|
Zfish     1 MGCCSGRCT----LIFLCTFQLMVALERQVFDFLGYQWAPILANFFHILVVILGLFGTIQYRPRY 61

  Fly    64 IITYLIWNFLWIGWNTFLICFYLNVGQLNRDSDLLNLG-TGSVSWFEANGYGC----KPTYNMAA 123
            |:.|.:|..||:.||.|:|||||.||.|::|||||... :...||:..:|.||    .|......
Zfish    62 IVVYTVWTALWVAWNVFVICFYLEVGGLSKDSDLLTFNISAHHSWWSEHGPGCIRREIPASGERG 126

  Fly   124 DDTFRPQRPERVEGCLLDYPLVEITHSGVQCALALLGILGAILISCIFLDEDDRFDFMNGDAKSP 188
            .||   |....:.||||:|..:|:.|||.|..::|||.:.|..:..:..:|:|.|||:.|....|
Zfish   127 ADT---QSYISIMGCLLEYQYIEVLHSGCQILISLLGFIYACYVISVITEEEDSFDFIGGFDPFP 188

  Fly   189 -QHTVVHPMYVSYTSIPTTS 207
             .|....|.::....:|.:|
Zfish   189 LYHVNEKPSHLLLKPVPQSS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKAINNP_001246506.1 NKAIN 12..199 CDD:283329 82/192 (43%)
nkain4NP_001107118.1 NKAIN 10..203 CDD:283329 82/195 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573908
Domainoid 1 1.000 174 1.000 Domainoid score I3617
eggNOG 1 0.900 - - E1_KOG4556
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001076
OrthoInspector 1 1.000 - - otm24570
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13084
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4984
SonicParanoid 1 1.000 - - X730
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.