DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and ACA1

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_010964.3 Gene:ACA1 / 856769 SGDID:S000000847 Length:489 Species:Saccharomyces cerevisiae


Alignment Length:417 Identity:82/417 - (19%)
Similarity:141/417 - (33%) Gaps:125/417 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DMDHLASVSFGDFETKSPEGDVSCYQNFRAQTEHVSLDISLGQKS---------DTLF------- 54
            |:.||...:...|::..|..|...|:.        .:.||.||.|         :.|:       
Yeast    76 DISHLPITNPPIFQSSLPAFDQPVYKR--------RISISNGQISQLGEDLETVENLYNCQPPIL 132

  Fly    55 --AADQTPTPTRLIKNCDEVGLFEDLQHVNPFDIGFQQAAERNVSGTPSR-------PEARPNDG 110
              .|.|.|.|.               |..||....:...:...:...|..       |||.|..|
Yeast   133 SSKAQQNPNPQ---------------QVANPSAAIYPSFSSNELQNVPQPHEQATVIPEAAPQTG 182

  Fly   111 ESLHTPQVYPVEAP-------TVVSVPSENQVPQ---SVSCGDMDVDQLLATTVTSPSKASQDGP 165
                :..:|....|       .:.:|.:...:|.   |:..||..::|....             
Yeast   183 ----SKNIYAAMTPYDSNIKLNIPAVAATCDIPSATPSIPSGDSTMNQAYIN------------- 230

  Fly   166 PPLQL-IQPQVLT--W---------VLPA--QSVPISIATVDCNRNRVKPTGAIHPFILPKPTAK 216
              :|| :|.|:.|  |         ..||  .||..|.:..:.|.:.:: ..::|..|.......
Yeast   231 --MQLRLQAQMQTKAWKNAQLNVHPCTPASNSSVSSSSSCQNINDHNIE-NQSVHSSISHGVNHH 292

  Fly   217 ELNKTSKRPEPILVSCNPPNNEPSSASLTPTSQLP-IKERLKAIIHSNNNRRSFSTPP------- 273
            .:|.:.:..|..:.|..|..::....:||..:..| .|:...|:.::.|:.:...|.|       
Yeast   293 TVNNSCQNAELNISSSLPYESKCPDVNLTHANSKPQYKDATSALKNNINSEKDVHTAPFSSMHTT 357

  Fly   274 ----------------------KAAKAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQL 316
                                  ..|||..|:|   .:||.|.|||:.|.:.:.....|.::..|:
Yeast   358 ATFQIKQEARPQKIENNTAGLKDGAKAWKRAR---LLERNRIAASKCRQRKKMSQLQLQREFDQI 419

  Fly   317 QQENQELHERISRLEKELQQHRSHSSL 343
            .:||..:.::|...||.:|:.:..|.|
Yeast   420 SKENTMMKKKIENYEKLVQKMKKISRL 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 7/35 (20%)
ACA1NP_010964.3 bZIP_ATF2 386..442 CDD:269835 17/58 (29%)
coiled coil 387..438 CDD:269835 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19304
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.