DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Atf-2 and FOSL1

DIOPT Version :9

Sequence 1:	NP_001033973.1	Gene:	Atf-2 / 37978	FlyBaseID:	FBgn0265193	Length:	381	Species:	Drosophila melanogaster
Sequence 2:	NP_005429.1	Gene:	FOSL1 / 8061	HGNCID:	13718	Length:	271	Species:	Homo sapiens

Alignment Length:	192	Identity:	40/192 - (20%)
Similarity:	64/192 - (33%)	Gaps:	71/192 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly   157 PSKASQDGPPPLQ-LIQPQVLTWVLPAQSVPISIATVDCNRNRVKPTGAIHPFILPKP-TAKELN 219
            ||..:..|...|| ::||..|                             .|...|:| |..:.:
Human    39 PSINTMSGSQELQWMVQPHFL-----------------------------GPSSYPRPLTYPQYS 74

  Fly   220 KTSKRPEPILVSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNNNRRSFSTPPKAAKAKDRSRD 284
            ....||..|.....||.               ::.|                |.:....::..|.
Human    75 PPQPRPGVIRALGPPPG---------------VRRR----------------PCEQISPEEEERR 108

  Fly   285 EDCMERRRAAASRYRNKMRNEHKDLIK--------QNAQLQQENQELHERISRLEKELQQHR 338
            ....||.:.||::.||: |.|..|.::        :.:.||:|.:||.::..|||..|:.||
Human   109 RVRRERNKLAAAKCRNR-RKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHR 169

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Atf-2	NP_001033973.1	Cnn_1N	<300..336	CDD:285263	13/43 (30%)
FOSL1	NP_005429.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..34
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	68..112		9/74 (12%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	107..127		7/20 (35%)
		bZIP_Fos	115..168	CDD:269869	16/53 (30%)
		coiled coil	115..167	CDD:269869	16/52 (31%)
		PRK13729	129..>250	CDD:184281	12/41 (29%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	133..161		5/27 (19%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	173..202
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	237..271
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R103
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.030