Sequence 1: | NP_001033973.1 | Gene: | Atf-2 / 37978 | FlyBaseID: | FBgn0265193 | Length: | 381 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009289400.1 | Gene: | fosl1a / 564241 | ZFINID: | ZDB-GENE-061207-7 | Length: | 347 | Species: | Danio rerio |
Alignment Length: | 316 | Identity: | 70/316 - (22%) |
---|---|---|---|
Similarity: | 110/316 - (34%) | Gaps: | 111/316 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 132 ENQVPQSVSCGDMDVDQLLATTVTSPSKASQ------DGP--PPLQLI-QPQVLTWVLPAQSVPI 187
Fly 188 SIATVDCNRNRVKPTGAIHPFILPKPTAKELNKTSKRPEPILVSCNPPNNEPSSASLTPTSQLPI 252
Fly 253 KERLKAIIHSNNNRR-SFSTPPKAAKAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQL 316
Fly 317 QQENQELHERISRLEKE----------------LQQHRSHS-------SLAGVVAD--------- 349
Fly 350 ---------------QLRIPP--------------SSIH--LLINVPNVLVPSSAS 374 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Atf-2 | NP_001033973.1 | Cnn_1N | <300..336 | CDD:285263 | 11/51 (22%) |
fosl1a | XP_009289400.1 | bZIP_Fos | 144..197 | CDD:269869 | 14/52 (27%) |
coiled coil | 144..196 | CDD:269869 | 14/51 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R103 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |