DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and fosl1a

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_009289400.1 Gene:fosl1a / 564241 ZFINID:ZDB-GENE-061207-7 Length:347 Species:Danio rerio


Alignment Length:316 Identity:70/316 - (22%)
Similarity:110/316 - (34%) Gaps:111/316 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ENQVPQSVSCGDMDVDQLLATTVTSPSKASQ------DGP--PPLQLI-QPQVLTWVLPAQSVPI 187
            :...|:|.|.........:|||..:..:..|      .|.  |.|..| ..|.|.|:|..     
Zfish    12 DRSFPESSSGSSGSSSASVATTTGTTQQQQQKYSVAGSGQFVPSLNAITSNQSLQWMLQP----- 71

  Fly   188 SIATVDCNRNRVKPTGAIHPFILPKPTAKELNKTSKRPEPILVSCNPPNNEPSSASLTPTSQLPI 252
            ||.|                   |.| ::.|..:...|..|..:.|||  :||.:.|:....:  
Zfish    72 SIGT-------------------PGP-SRALRSSYPLPPGIPATMNPP--QPSQSHLSRPGVI-- 112

  Fly   253 KERLKAIIHSNNNRR-SFSTPPKAAKAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQL 316
              |..|.|.|...|. .:.:|.:..:.:.|      .||.:.||::.||:.|.....|..:..||
Zfish   113 --RAAAAIGSTTRRNDEYLSPEELERRRIR------RERNKMAAAKCRNRRRELTDTLQNETDQL 169

  Fly   317 QQENQELHERISRLEKE----------------LQQHRSHS-------SLAGVVAD--------- 349
            :.|...|.:.|:.|:||                :|:..|.|       ||:|:..:         
Zfish   170 EDEKSRLQKEIADLQKEKEKLELVFEAHRPICKVQESESDSDSSNDIPSLSGIKIEPVDPDLPGP 234

  Fly   350 ---------------QLRIPP--------------SSIH--LLINVPNVLVPSSAS 374
                           ::.|||              .|:|  :||:.|: |.|.:||
Zfish   235 SRETKHYAKINKPKPKITIPPPPSASSITGIPLESESLHTPVLISTPS-LTPFTAS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 11/51 (22%)
fosl1aXP_009289400.1 bZIP_Fos 144..197 CDD:269869 14/52 (27%)
coiled coil 144..196 CDD:269869 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.