DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and fosl2

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001076467.1 Gene:fosl2 / 558921 ZFINID:ZDB-GENE-070209-164 Length:341 Species:Danio rerio


Alignment Length:300 Identity:70/300 - (23%)
Similarity:104/300 - (34%) Gaps:91/300 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GFQQAAERNVSGTPSRPEARPNDGESLHTPQVYPVEAPTVVS--VPSENQVPQSVSCGDMDVDQL 149
            |....:.|..|.:|:.|:..|....|.   |.|.::.|...|  :|:.|.:              
Zfish     7 GTYDTSSRGSSSSPAHPDTSPIPASSY---QKYRIDMPGSSSAFIPTINAI-------------- 54

  Fly   150 LATTVTSPSKASQDGPPPLQ-LIQPQVLTWVLPAQSVPISIATVDCNRNRVKPTGAIHPFILPKP 213
              ||       |||    || ::||.|:|    :.|.|.|           :|    ||:.|...
Zfish    55 --TT-------SQD----LQWMVQPTVIT----SMSNPYS-----------RP----HPYGLSVS 87

  Fly   214 TAKEL--NKTSKRPEPILVSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNNNRRSFSTPPKAA 276
            :...|  :....||..|....:..........|||      :|..|..:....|        |.|
Zfish    88 SGPSLLGHTALTRPGVIRSIGDARGRRKRDEQLTP------EEEEKRRVRRERN--------KLA 138

  Fly   277 KAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQEL------HERISRLEKELQ 335
            .||.|:|..:..|..:...    .|:..|..||.|:...||:|..:|      |..:.:|..|.:
Zfish   139 AAKCRNRRRELTEMLQGET----EKLEEEKADLQKEIETLQKEKDKLEFMLVAHNPVCKLPPEER 199

  Fly   336 QHRSHSSLAGVVADQLRIPPSSIHLLINVPNVLVPSSASN 375
            ...|||        |..:|     |.:.:.:.|||....|
Zfish   200 HQSSHS--------QQCVP-----LPLTMRSNLVPRGPMN 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 12/41 (29%)
fosl2NP_001076467.1 bZIP_Fos 135..188 CDD:269869 17/64 (27%)
coiled coil 135..187 CDD:269869 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.