DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and Creb5

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001128093.1 Gene:Creb5 / 500131 RGDID:1566107 Length:561 Species:Rattus norvegicus


Alignment Length:441 Identity:102/441 - (23%)
Similarity:152/441 - (34%) Gaps:166/441 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CYQNFRAQTEHVSL-----DISL---GQKSDTLFAADQTPTPTRLIKNCDEVGLFEDLQHVNPFD 85
            |.|.|..: :|:.:     :::|   ..|:|.:. :||||||||.:|||:|||||.:|.  ..|:
  Rat    76 CSQRFPTE-DHLMIHRHKHEMTLKFPSIKTDNML-SDQTPTPTRFLKNCEEVGLFSELD--CSFE 136

  Fly    86 IGFQQAAE-----RNVS------GTPSRPEAR-------PNDGESLHTPQVY--PVEAPTVVSVP 130
            ..|::|.|     ||:|      ||.:.|.|.       ||...|:...|..  |..:..:...|
  Rat   137 HEFRKAQEEESSKRNISMHNTVGGTMTGPGAHQLGSSRMPNHDTSVVIQQAMPSPQSSSVITQAP 201

  Fly   131 SENQ----VPQSVSCGDMDVDQL--LATTVTSPSKASQDG--PPPLQLIQPQVLTWVLPAQSVPI 187
            |.|:    ||.|:|       .|  |......|..||..|  |.|.......||..:....||..
  Rat   202 STNRQIGPVPGSLS-------SLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNS 259

  Fly   188 SIATVD-------CNRNRVKPT------------------------------------------- 202
            ||..:.       |...:|:|.                                           
  Rat   260 SIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMSTIGHMMEMMGSRQDQTPH 324

  Fly   203 -------------------------GAIHPFILPKPTAKE----------------LNKTSKRPE 226
                                     .|.||.  |:|..::                .::||  |.
  Rat   325 HHMHSHPHQHQTLPPHHPYPHQHQHPAHHPH--PQPHHQQNHPHHHSHSHLHAHPAHHQTS--PH 385

  Fly   227 PILVSCNPPNNEPSSASLTPTSQL----PIKERLKAIIHS--NNNRRSFSTPPKAAKAKDRSRDE 285
            |.|.:.|.....|::..:.||..:    |...|.:.::..  :..||.|                
  Rat   386 PPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKF---------------- 434

  Fly   286 DCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRLEKELQQ 336
              :||.||||:|.|.|.:.....|.|:..:|.|.|.:|...:|.|:.|:.|
  Rat   435 --LERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQ 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 10/35 (29%)
Creb5NP_001128093.1 bZIP_ATF2 430..489 CDD:269835 22/72 (31%)
coiled coil 430..489 CDD:269835 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I9992
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5046
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D415378at33208
OrthoFinder 1 1.000 - - FOG0001072
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19304
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.160

Return to query results.
Submit another query.