DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and ATF1

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_016874820.1 Gene:ATF1 / 466 HGNCID:783 Length:279 Species:Homo sapiens


Alignment Length:333 Identity:66/333 - (19%)
Similarity:118/333 - (35%) Gaps:94/333 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SLDISLGQKSDTLFAADQTPTPTRLIKNCDEVGLFEDLQHVNPFD--------IGFQQAAERNVS 97
            ||.:....||.|   ::..|.|...::......:.:.:..::..:        ||..|.|...::
Human     6 SLIMEDSHKSTT---SETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILA 67

  Fly    98 GTPS-----------RPEARPNDGE-----------SLHTPQVYPVEAPTVVSVPSENQVPQSVS 140
            ..||           ....|..|||           |:.|| :|...:...::: :.|...|..|
Human    68 RRPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTP-IYQTSSGQYIAI-APNGALQLAS 130

  Fly   141 CGDMDVDQLLATTVTSPSKASQDGPPPLQLIQ----PQVLTWVLPAQSVPISIATVDCNRNRVKP 201
            .|...|..|...|:|: |.::|.|...||..|    .|:|   :|:..|.:..|:.|....:::.
Human   131 PGTDGVQGLQTLTMTN-SGSTQQGTTILQYAQTSDGQQIL---VPSNQVVVQTASGDMQTYQIRT 191

  Fly   202 TGAIHPFILPKPTAKELNKTSKRPEPILVSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNNNR 266
            |          |:|..|.:|.....|:.:          ::..|.|....:|..::         
Human   192 T----------PSATSLPQTVVMTSPVTL----------TSQTTKTDDPQLKREIR--------- 227

  Fly   267 RSFSTPPKAAKAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRLE 331
                                 :.:.|.||...|.|.:...|.|..:.|.|:.:|:.|.|.:..| 
Human   228 ---------------------LMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTL- 270

  Fly   332 KELQQHRS 339
            |:|..::|
Human   271 KDLYSNKS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 11/35 (31%)
ATF1XP_016874820.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.