DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and fosab

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_991132.1 Gene:fosab / 394198 ZFINID:ZDB-GENE-031222-4 Length:349 Species:Danio rerio


Alignment Length:173 Identity:49/173 - (28%)
Similarity:74/173 - (42%) Gaps:35/173 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 SSASLTPT----SQLP-----IKERLKAIIHSNNNRRSF--STPPK-----AAKAKDRSRDEDC- 287
            ||||..||    |..|     ::..:.::..||...:|:  |:.||     |..:..|||.|.. 
Zfish    43 SSASFVPTVTAISSCPDLQWMVQPMISSVAPSNGAAQSYNPSSYPKMRVTGAKTSNKRSRSEQLS 107

  Fly   288 ----------MERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRLEKELQQHR---- 338
                      .||.:.||::.||:.|.....|..:..||:.|...|...|:.|.||.::..    
Zfish   108 PEEEEKKRVRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQNDIANLLKEKERLEFILA 172

  Fly   339 SHSSLAGVVADQLRIPPSSIHL-LINVPNVL---VPSSASNAS 377
            :|..:..:.||.....|||..: .|:||.::   |.||..|.|
Zfish   173 AHKPICKIPADASFPEPSSSPMGSISVPEIVTTSVVSSTPNTS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 11/35 (31%)
fosabNP_991132.1 bZIP_Fos 113..174 CDD:269869 16/60 (27%)
coiled coil 114..173 CDD:269869 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.