DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and kay

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:389 Identity:79/389 - (20%)
Similarity:136/389 - (34%) Gaps:94/389 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SCYQNFRAQTEHVSLDISLG---QKSDTLFAADQTPTPTRLIKNCDEVGLFEDLQHVNPFDIGFQ 89
            :|.....|.|...:...:.|   ..||. ||.|.:...|.|...     ||  ||.:..|:.|  
  Fly   187 TCNTTAAATTSTTATSAAAGSDNNHSDN-FAMDASEIATFLANE-----LF--LQQLGNFETG-- 241

  Fly    90 QAAERNVSGTPSRPEARPNDGESLHTPQVYPVEA----PTVVSVPSENQVPQSVSCGDMDVDQLL 150
                ::|.              :|.||.:.|...    .|:..:.|:.|..:...|....|.::|
  Fly   242 ----QSVL--------------TLTTPTLTPTTTRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVL 288

  Fly   151 ATTVTSPSKASQDGPPPLQLIQPQVLTWVLPAQSVPISIATVDCNRNRVKPTGAIHPFILPKPTA 215
            ...:.........|...|.|.|...|:....::|...:.:..|...|..:.|        ...::
  Fly   289 PNAIDVLGMGIPTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDT--------TDTSS 345

  Fly   216 KELNKTSKRPEPIL---VSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNN------------- 264
            ...:.||.:...|:   |:....||..:..:...:|      |..|.:.|:|             
  Fly   346 AHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSS------RGSASVGSSNANTSNTPARRGGG 404

  Fly   265 ---NRRSFSTPPKAAKAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHER 326
               ||.:..||.:..|...|      .||.:.||:|.|.:..::..:|.::..||::..:.:.:.
  Fly   405 RRPNRSTNMTPEEEQKRAVR------RERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKE 463

  Fly   327 I-------SRLEKELQQHRS-----HSSLAGVVADQLRIPPSSIHLLINVPNVLVPSSASNASA 378
            |       ::||..|..||:     .|.:..||.....|.|:.:        :...||.|.||:
  Fly   464 IEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGL--------LSAGSSGSGASS 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 7/42 (17%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 15/66 (23%)
coiled coil 421..480 CDD:269869 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.