DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and atf1

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_956017.1 Gene:atf1 / 325609 ZFINID:ZDB-GENE-030131-4334 Length:304 Species:Danio rerio


Alignment Length:351 Identity:74/351 - (21%)
Similarity:118/351 - (33%) Gaps:122/351 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TAGDMDHLASVSF------------GDFETKSPEGDVSCYQNFRAQTEHVSLDISLGQKSDTLFA 55
            ||..:..:|.:|.            |.|:.   :|.:...|:...|:..|.   |.||.||:   
Zfish    22 TASHLSQIAQMSLGGNPVAVVQLPSGQFQV---QGVIQSAQSSVIQSPPVQ---SQGQGSDS--- 77

  Fly    56 ADQTPTPTRLIKNCDEVGLFEDLQHVNPFDIGFQQAAE--------RNVSGTPSRPE-ARPNDGE 111
                                :|.|..:......|::.|        |.:....|..| |..|:||
Zfish    78 --------------------DDSQESSDSGASNQKSREILARRPSYRKILNDLSAEELATQNEGE 122

  Fly   112 ------------SLHTPQVYPVEAPTVVSVPSENQVPQSVSCGDMDVDQLLATTVTSPSKASQDG 164
                        ||.|| :|.......:::.|...: |..|.|...| |.|.|...|.|..||  
Zfish   123 EESSTSSAITSVSLPTP-IYQTSTGQYIAISSNGSL-QLASAGSEGV-QGLQTLTMSNSNPSQ-- 182

  Fly   165 PPPLQLIQ----PQVLTWVLPAQSVPISIATVDCNRNRVKPTGAIHP--FILPKPTAKELNKTSK 223
            |..||..|    .|:|   ||:..|.:..|..:....:::.:.:..|  .::..|.   :|...|
Zfish   183 PTILQYAQTADGQQIL---LPSNQVVLQGAGGEMQAYQIRSSSSSLPQTVVMTSPV---INSQGK 241

  Fly   224 RPEPILVSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNNNRRSFSTPPKAAKAKDRSRDE--D 286
            ..:|                           ::|..|....||       :||:...|.:.|  .
Zfish   242 SDDP---------------------------QMKREIRLAKNR-------EAARECRRKKKEYVK 272

  Fly   287 CMERRRAAASRYRNKMRNEHKDLIKQ 312
            |:|.|.|.       :.|::|.||::
Zfish   273 CLENRVAV-------LENQNKTLIEE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 4/13 (31%)
atf1NP_956017.1 pKID 87..118 CDD:280355 6/30 (20%)
bZIP_CREB1 248..302 CDD:269838 16/58 (28%)
coiled coil 249..301 CDD:269838 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.