powered by:
Protein Alignment Atf-2 and pcr1
DIOPT Version :9
Sequence 1: | NP_001033973.1 |
Gene: | Atf-2 / 37978 |
FlyBaseID: | FBgn0265193 |
Length: | 381 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_594500.1 |
Gene: | pcr1 / 2542047 |
PomBaseID: | SPAC21E11.03c |
Length: | 171 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 72 |
Identity: | 21/72 - (29%) |
Similarity: | 37/72 - (51%) |
Gaps: | 11/72 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 278 AKDRSRDED----CMERRRAAASRYRNKMRNEHKDL-------IKQNAQLQQENQELHERISRLE 331
||.:..|:: .:||.|.|||::|.|.:...|:| .:|:.:||....:|.:...||:
pombe 3 AKKKEVDDEKRRRILERNRIAASKFRQKKKEWIKELEQTANAAFEQSKRLQLLLSQLQQEAFRLK 67
Fly 332 KELQQHR 338
.:|..|:
pombe 68 SQLLAHQ 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001072 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R103 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.