DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and pcr1

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_594500.1 Gene:pcr1 / 2542047 PomBaseID:SPAC21E11.03c Length:171 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:21/72 - (29%)
Similarity:37/72 - (51%) Gaps:11/72 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 AKDRSRDED----CMERRRAAASRYRNKMRNEHKDL-------IKQNAQLQQENQELHERISRLE 331
            ||.:..|::    .:||.|.|||::|.|.:...|:|       .:|:.:||....:|.:...||:
pombe     3 AKKKEVDDEKRRRILERNRIAASKFRQKKKEWIKELEQTANAAFEQSKRLQLLLSQLQQEAFRLK 67

  Fly   332 KELQQHR 338
            .:|..|:
pombe    68 SQLLAHQ 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 10/42 (24%)
pcr1NP_594500.1 bZIP_ATF2 12..72 CDD:269835 17/59 (29%)
coiled coil 12..72 CDD:269835 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001072
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.