DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and atf31

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_593039.1 Gene:atf31 / 2541860 PomBaseID:SPAC22F3.02 Length:209 Species:Schizosaccharomyces pombe


Alignment Length:230 Identity:44/230 - (19%)
Similarity:81/230 - (35%) Gaps:57/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 YPVEAPTVVS-VPSE------NQVPQSVSCGDMDVDQLLATTVTSPSKASQDGPPPLQLIQPQVL 176
            |....||..| :|..      |.:..|....|:.:.|.|..:               |.:|.|:|
pombe     3 YETNTPTEESIIPKHEDGEEYNSIYLSRFEKDISISQTLDFS---------------QFMQTQIL 52

  Fly   177 TWVLPAQSVPISIATVDCNRNRVKPTGAIHPFILPKPTAKELNKTSKRPEPILV---SCNPPNNE 238
               |.|:...:.:..   :|:.:..    .|:.:.:....||::.:....|.::   |.|.|:.|
pombe    53 ---LTAKRKALELGD---DRSPINN----DPYNIRRSDFDELSEYTASKSPSIISEASHNSPSRE 107

  Fly   239 PSSASLTPTSQLPIKERLKAIIHSNNNRRSFSTPPKAAKAKDRSRDEDCMERRRAAASRYRNKMR 303
            ...:....||:|.                  .|.....||::|...:.|    |....:|...::
pombe   108 LDDSGDENTSKLT------------------GTKQSMLKARNRQAAQKC----RIKKKKYLQTLQ 150

  Fly   304 NEHKDLIKQNAQLQQENQELHERISRLEKELQQHR 338
            ::......:|.:|.|...:|.|.|.:|...:..||
pombe   151 DQVNYYTSENKELLQSANDLREEIIKLRTLVFAHR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 7/35 (20%)
atf31NP_593039.1 bZIP_ATF2 123..183 CDD:269835 13/63 (21%)
coiled coil 123..183 CDD:269835 13/63 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001072
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19304
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.