DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and FOSL2

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_006712039.1 Gene:FOSL2 / 2355 HGNCID:3798 Length:343 Species:Homo sapiens


Alignment Length:340 Identity:68/340 - (20%)
Similarity:117/340 - (34%) Gaps:122/340 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LFEDLQHVNPFDIGFQQAAERNVSGTPSRPEARPNDGESLHTPQVYPVEAPTVVS--VPSENQVP 136
            :::|  :...||     .:.|..||:|:..|:..:.|..   .|.:.|:.|...|  :|:.|.: 
Human     1 MYQD--YPGNFD-----TSSRGSSGSPAHAESYSSGGGG---QQKFRVDMPGSGSAFIPTINAI- 54

  Fly   137 QSVSCGDMDVDQLLATTVTSPSKASQDGPPPLQ-LIQPQVLTWVLPAQSVPISIATVDCNRNRVK 200
                           ||       |||    || ::||.|:|                   :...
Human    55 ---------------TT-------SQD----LQWMVQPTVIT-------------------SMSN 74

  Fly   201 PTGAIHPFILPKPTAKELNKTSKRPEPILVSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNNN 265
            |....||:                 .|:          |..||:.....||....:|.|..:...
Human    75 PYPRSHPY-----------------SPL----------PGLASVPGHMALPRPGVIKTIGTTVGR 112

  Fly   266 RRSFSTPPKAAKAKDRSRDEDCMERRRAAASRYRNKMRN---------------EHKDLI--KQN 313
            ||.........:.|.|.|    .||.:.||::.||:.|.               .|..|.  ::.
Human   113 RRRDEQLSPEEEEKRRIR----RERNKLAAAKCRNRRRELTEKLQAIGPWQVAVPHIPLFPWQET 173

  Fly   314 AQLQQENQELHERISRLEKELQQHR----SHSSLAGVVADQLRIPPS-----------SIHLLIN 363
            .:|::|...|.:.|:.|:||.::..    :|..:..:..::.|.||:           |:..::.
Human   174 EELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVV 238

  Fly   364 VPNVLVPSSASNASA 378
            ....|...|.|::||
Human   239 KQEPLEEDSPSSSSA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 11/52 (21%)
FOSL2XP_006712039.1 bZIP_Fos 134..204 CDD:269869 14/69 (20%)
coiled coil 134..195 CDD:269869 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.