DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and Creb5

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_036021932.1 Gene:Creb5 / 231991 MGIID:2443973 Length:508 Species:Mus musculus


Alignment Length:441 Identity:102/441 - (23%)
Similarity:152/441 - (34%) Gaps:166/441 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CYQNFRAQTEHVSL-----DISL---GQKSDTLFAADQTPTPTRLIKNCDEVGLFEDLQHVNPFD 85
            |.|.|..: :|:.:     :::|   ..|:|.:. :||||||||.:|||:|||||.:|.  ..|:
Mouse    23 CSQRFPTE-DHLMIHRHKHEMTLKFPSIKTDNML-SDQTPTPTRFLKNCEEVGLFSELD--CSFE 83

  Fly    86 IGFQQAAE-----RNVS------GTPSRPEAR-------PNDGESLHTPQVY--PVEAPTVVSVP 130
            ..|::|.|     ||:|      ||.:.|.|.       ||...|:...|..  |..:..:...|
Mouse    84 HEFRKAQEEENSKRNISMHNTVGGTMTGPGAHQLGSTRMPNHDSSVVIQQAMPSPQSSSVITQAP 148

  Fly   131 SENQ----VPQSVSCGDMDVDQL--LATTVTSPSKASQDG--PPPLQLIQPQVLTWVLPAQSVPI 187
            |.|:    ||.|:|       .|  |......|..||..|  |.|.......||..:....||..
Mouse   149 STNRQIGPVPGSLS-------SLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNS 206

  Fly   188 SIATVD-------CNRNRVKPT------------------------------------------- 202
            ||..:.       |...:|:|.                                           
Mouse   207 SIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMSTIGHMMEMMGSRQDQTPH 271

  Fly   203 -------------------------GAIHPFILPKPTAKE----------------LNKTSKRPE 226
                                     .|.||.  |:|..::                .::||  |.
Mouse   272 HHLHSHPHQHQTLPPHHPYPHQHQHPAHHPH--PQPHHQQNHPHHHSHSHLHAHPAHHQTS--PH 332

  Fly   227 PILVSCNPPNNEPSSASLTPTSQL----PIKERLKAIIHS--NNNRRSFSTPPKAAKAKDRSRDE 285
            |.|.:.|.....|::..:.||..:    |...|.:.::..  :..||.|                
Mouse   333 PPLPTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKF---------------- 381

  Fly   286 DCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRLEKELQQ 336
              :||.||||:|.|.|.:.....|.|:..:|.|.|.:|...:|.|:.|:.|
Mouse   382 --LERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQ 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 10/35 (29%)
Creb5XP_036021932.1 bZIP_ATF2 377..436 CDD:269835 22/72 (31%)
coiled coil 378..429 CDD:269835 21/68 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5273
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D415378at33208
OrthoFinder 1 1.000 - - FOG0001072
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.