DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and fos-1

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001033481.1 Gene:fos-1 / 178987 WormBaseID:WBGene00001345 Length:467 Species:Caenorhabditis elegans


Alignment Length:226 Identity:48/226 - (21%)
Similarity:85/226 - (37%) Gaps:74/226 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 NRVKPTGAIHPFILPKPTAKELNKTSKRPEPILVSCNP--PNN---------------EPSS--A 242
            |:..||..|.|   |:....::::......| |..|.|  |:|               :||.  :
 Worm    34 NQAHPTSVIVP---PRQHHHQIHQQQTDNSP-LTPCTPYYPSNAYGLPLFFGTDFLQFQPSDIPS 94

  Fly   243 SLTPTSQLPIKER----LKAIIHSNNNRRSF--------STP------PKAAKAKDRSRDEDCME 289
            .|||....|:...    :.||..:....|:|        |:|      .|.:.|..:.::||.||
 Worm    95 PLTPNISSPLTPHPFGPIPAIPTNQIYNRTFTDFYSTAASSPMVQYSTVKKSSAGRKPKEEDNME 159

  Fly   290 ------------RRRAAASRYRNK-------MRNEHKDLIKQNAQLQQENQELHERISRLEKELQ 335
                        |.:.||:|.|.:       ::::..|....|.:...|...:..:::.|:..|:
 Worm   160 DDDDDKRLKRRQRNKEAAARCRQRRIDLMKELQDQVNDFKNSNDKKMAECNNIRNKLNSLKNYLE 224

  Fly   336 QH--------RSHSSLAGVVADQLRIPPSSI 358
            .|        |:|.      .::|.||||::
 Worm   225 THDCKLSREERTHE------INRLIIPPSTV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 5/42 (12%)
fos-1NP_001033481.1 bZIP_Fos_like 165..223 CDD:269847 9/57 (16%)
coiled coil 166..223 CDD:269847 9/56 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.