DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and ATF2

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001243019.1 Gene:ATF2 / 1386 HGNCID:784 Length:505 Species:Homo sapiens


Alignment Length:461 Identity:114/461 - (24%)
Similarity:185/461 - (40%) Gaps:131/461 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CYQNFRAQTEHVS-------LDISLG-QKSDTLFAADQTPTPTRLIKNCDEVGLFEDLQHVNPFD 85
            |.|.| ...:|::       :.:..| .::|::..|||||||||.:|||:|||||.:|  .:||:
Human    32 CGQRF-TNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNEL--ASPFE 93

  Fly    86 IGFQQAAERNVSGTPSRPEARPNDGESLHTPQV-YPVEAPTVVSVPSENQV---PQSVSCGDMDV 146
            ..|::|:|.::       :..|.|...|.||.: ..:|.|:||....::..   |:|.:..:.:|
Human    94 NEFKKASEDDI-------KKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEV 151

  Fly   147 DQLLATTVTSPSKASQDGPPPLQLIQPQVL-----TWVLPAQSVP----ISIATVDCNRNR-VKP 201
            .  ||.|....|...:  |..||:  |.||     :.|:..|:||    .::.|...:.|| :.|
Human   152 P--LAQTAQPTSAIVR--PASLQV--PNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVP 210

  Fly   202 TGAIHPFILPKPTAKELNKTSKRPEPILVSCNPPN-NEPSSASLT--------------PTSQLP 251
            .....|.:|..|..:.:      |..|..|....| :.|::..|.              |:|..|
Human   211 VPGPFPLLLHLPNGQTM------PVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQP 269

  Fly   252 I----KERLKAII---------------HSNNNRRSFS------------------------TPP 273
            :    |.||||.:               |.:...|:.|                        |.|
Human   270 VQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTP 334

  Fly   274 KAAKAKDRSR---DED-------CMERRRAAASRYRNK-------MRNEHKDLIKQNAQLQQENQ 321
            :......|.|   :||       .:||.||||||.|.|       :..:.:||...|.|||.|..
Human   335 QTQSTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVT 399

  Fly   322 ELHERISRLEKELQQHRS------------HSSLAGVVADQLRIPPSSIHLLINVPNVLVPSSAS 374
            .|...:::|::.|..|:.            |::.....::.:.:|.|.....|...:|...:..|
Human   400 LLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVS 464

  Fly   375 NASAAK 380
            :.|.|:
Human   465 STSKAE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 11/42 (26%)
ATF2NP_001243019.1 Nuclear export signal 1 (N-NES) 1..7
C2H2 Zn finger 27..49 CDD:275370 4/17 (24%)
GCN4_cent 65..102 CDD:213399 22/38 (58%)
Herpes_BLLF1 <90..342 CDD:282904 57/270 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..155 7/31 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..373 26/113 (23%)
Essential for its histone acetyltransferase activity 296..299 0/2 (0%)
bZIP_ATF2 354..414 CDD:269835 20/59 (34%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 354..374 10/19 (53%)
coiled coil 355..406 CDD:269835 18/50 (36%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 380..408 8/27 (30%)
Nuclear export signal 2 (C-NES) 405..414 2/8 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..472 8/46 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10581
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5177
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D415378at33208
OrthoFinder 1 1.000 - - FOG0001072
OrthoInspector 1 1.000 - - oto89759
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19304
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.