DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and CREB1

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001358355.1 Gene:CREB1 / 1385 HGNCID:2345 Length:341 Species:Homo sapiens


Alignment Length:370 Identity:79/370 - (21%)
Similarity:123/370 - (33%) Gaps:105/370 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LASVSFGDFETKSPEGDVSCYQNFRAQTEHVSLDISLGQKSDTLFAADQTPTPTRLIKNCDEV-G 73
            ||.||.......|....|:..|....||..|...|...|.|     ..|:|....:..:|.:: .
Human    36 LAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPS-----VIQSPQVQTVQSSCKDLKR 95

  Fly    74 LFEDLQHVNPFDIGFQQAAERNVSGTPSRPE---ARP------ND----------------GESL 113
            ||...|.....:....|.:..:|:.:..|.|   .||      ||                .|..
Human    96 LFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEET 160

  Fly   114 HTPQVYPVEAPTVVSVPSENQ--------VPQSVSCGDMDVDQLLATTVTSPSKASQDGPPPLQL 170
            ..|.:..|..||.:...|..|        ..|..:.|...|..|...|:|: :.|:|.|...||.
Human   161 SAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTN-AAATQPGTTILQY 224

  Fly   171 IQ----PQVLTWVLPAQSVPISIATVDCNRNRVK--PTGAIHPFILPKPTAKELNKTSKRPEPIL 229
            .|    .|:|   :|:..|.:..|:.|....:::  ||..|.|                   .::
Human   225 AQTTDGQQIL---VPSNQVVVQAASGDVQTYQIRTAPTSTIAP-------------------GVV 267

  Fly   230 VSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNNNRRSFSTPPKAAKAKDRSRDEDCMERRRAA 294
            ::.:|                                   :.|.:.|:...|.|:...| :.|.|
Human   268 MASSP-----------------------------------ALPTQPAEEAARKREVRLM-KNREA 296

  Fly   295 ASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRLEKELQQHRS 339
            |...|.|.:...|.|..:.|.|:.:|:.|.|.:..| |:|..|:|
Human   297 ARECRRKKKEYVKCLENRVAVLENQNKTLIEELKAL-KDLYCHKS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 11/35 (31%)
CREB1NP_001358355.1 pKID 113..151 CDD:396650 7/37 (19%)
bZIP_CREB1 285..339 CDD:269838 17/55 (31%)
coiled coil 286..337 CDD:269838 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.