DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and fosl2

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_002938465.1 Gene:fosl2 / 100494449 XenbaseID:XB-GENE-6258093 Length:316 Species:Xenopus tropicalis


Alignment Length:304 Identity:65/304 - (21%)
Similarity:108/304 - (35%) Gaps:100/304 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LFEDLQHVNPFDIGFQQAAERNVSGTPSRPEARPNDGESLHTPQVYPVEAPTVVS--VPSENQVP 136
            :::|  :...||     ::.|..|.:|::||..|:...|....|.:..:.|...|  :|:.|.: 
 Frog     1 MYQD--YPGNFD-----SSSRGSSSSPAQPEGYPSSTLSTSILQKFRTDMPGSSSAFIPTVNAI- 57

  Fly   137 QSVSCGDMDVDQLLATTVTSPSKASQDGPPPLQ-LIQPQVLTWVLPAQSVPISIATVDCNRNRVK 200
                           ||       |||    || ::||.|:|                   :...
 Frog    58 ---------------TT-------SQD----LQWMVQPTVIT-------------------SMSN 77

  Fly   201 PTGAIHPFILPKPTAKELNKTSKRPEPILVSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNNN 265
            |.|..||:                          .::.|:.||:|..|.|.....:|.|..:...
 Frog    78 PYGRSHPY--------------------------SHSVPNLASVTGHSALQRPGVIKTIGTTAGR 116

  Fly   266 RRSFSTPPKAAKAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHERISRL 330
            ||.........:.|.|.|    .||.:.||::.||:.|.....|..:..:|:||...|.:.|:.|
 Frog   117 RRRDEQLSPEEEEKRRVR----RERNKLAAAKCRNRRRELTDKLQAETEKLEQEKSGLQKEIADL 177

  Fly   331 EKELQQHR----SHSSLAGVVADQLRIPPSSIHLLINVPNVLVP 370
            :||..:..    :||.:..:..|.          ..|.|.::.|
 Frog   178 QKEKDKLEFMLVAHSPMCKISTDD----------RTNAPQIVRP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 11/35 (31%)
fosl2XP_002938465.1 bZIP_Fos 138..191 CDD:269869 14/52 (27%)
coiled coil 138..190 CDD:269869 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.