DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf-2 and fosl1

DIOPT Version :9

Sequence 1:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_002939377.3 Gene:fosl1 / 100038288 XenbaseID:XB-GENE-6257957 Length:298 Species:Xenopus tropicalis


Alignment Length:212 Identity:49/212 - (23%)
Similarity:74/212 - (34%) Gaps:85/212 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 PIL--------VSCNPPNNE--------PSSASLTPTSQLPIKERLKAIIHSNN-------NRRS 268
            |||        |..|||..:        .||....||        |.||..|.:       :.|.
 Frog    28 PILGTSGMGHSVRLNPPPEDAQQKYPVHTSSGQFIPT--------LNAITSSQDLNWMIQPSVRP 84

  Fly   269 FSTPP-------------------KAAKAKDRSRDEDCMERRRAAASRYRNKM-----RNEHKDL 309
            .:.||                   :....:..|.:|:  ||||  ..|.|||:     ||..|:|
 Frog    85 LNLPPYQSPRHGVIRNMGGVLSMGRRRNGEHLSPEEE--ERRR--VRRERNKVAAAKCRNRRKEL 145

  Fly   310 I-----------KQNAQLQQENQELHERISRLEKELQQHR-------SHSSLAGVVADQLRIPPS 356
            .           ::.:.||:|..||.::..:||..|:.|:       ||.::..|  |..|:...
 Frog   146 TDYLQAETDKLEEEKSSLQKEIAELQKQKDKLELILEAHQPICKFPDSHHNMQQV--DSSRLVKK 208

  Fly   357 SIH------LLINVPNV 367
            ..|      ..:|:|.:
 Frog   209 EPHEESPRGPKVNLPRI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 14/51 (27%)
fosl1XP_002939377.3 bZIP_Fos 131..184 CDD:269869 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.