DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and NKX6-2

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_796374.2 Gene:NKX6-2 / 84504 HGNCID:19321 Length:277 Species:Homo sapiens


Alignment Length:225 Identity:71/225 - (31%)
Similarity:103/225 - (45%) Gaps:41/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AAAG--YGGI-------RSTYQHFGPQGGQDSGFPSPRSAL-GYP---FPPMHQNSYSGYHLGSY 92
            ||.|  .||:       .|...:|||......|:|.|.:.| |.|   :|.:.|.:       .:
Human    70 AAGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGA-------PW 127

  Fly    93 APPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAEL 157
            ..|..:.|.....:.||          .||| :..|..:|..|:..|.:.|::|:|||.||||.|
Human   128 RDPRLAGPAPAGGVLDK----------DGKK-KHSRPTFSGQQIFALEKTFEQTKYLAGPERARL 181

  Fly   158 AASLGLTQTQVKIWFQNRRSKYKKM----MKAAQGPGTNSGMPLGGGGPNPGQ----HSPNQMHS 214
            |.|||:|::|||:||||||:|::|.    |.:|:....:....|..||.:...    :.|...:|
Human   182 AYSLGMTESQVKVWFQNRRTKWRKRHAVEMASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNS 246

  Fly   215 GELANGRFLWAALETNGTLALVHSTGGNNG 244
            .:....|.|.....:|  ||||...||..|
Human   247 DDEKITRLLKKHKPSN--LALVSPCGGGAG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 29/52 (56%)
NKX6-2NP_796374.2 Repressor domain. /evidence=ECO:0000250|UniProtKB:D3Z4R4 89..142 13/59 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..155 7/33 (21%)
Homeobox 151..204 CDD:306543 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 7/39 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.