DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and HB18

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_177248.3 Gene:HB18 / 843431 AraportID:AT1G70920 Length:206 Species:Arabidopsis thaliana


Alignment Length:70 Identity:24/70 - (34%)
Similarity:38/70 - (54%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 EDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNR 175
            :||    |..|::.:|.|  .:..|...|...|.:...|...::.:||..|.|:|.||::|||||
plant    59 DDS----NSGGRRRKKLR--LTKEQSHLLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNR 117

  Fly   176 RSKYK 180
            |::.|
plant   118 RARSK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 20/56 (36%)
HB18NP_177248.3 HOX 66..122 CDD:197696 19/57 (33%)
HALZ 124..167 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.