DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and HB53

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_201471.1 Gene:HB53 / 836803 AraportID:AT5G66700 Length:228 Species:Arabidopsis thaliana


Alignment Length:113 Identity:31/113 - (27%)
Similarity:45/113 - (39%) Gaps:22/113 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSL------------------- 134
            |||...|..:.|::...|.....|.| ..:...|:.||.|:..||.                   
plant    13 LGSQVYPYTTQPQNSHCIIVNQIDGG-EESKPVKRRRKRRSKGSSATNEEDVAEIGGMLRKRKLT 76

  Fly   135 --QLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYK 180
              |:..|...|.....|....:.::|..|||...||.:||||||:::|
plant    77 DEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 19/73 (26%)
HB53NP_201471.1 Homeobox 75..125 CDD:395001 17/50 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.