DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and HB51

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:121 Identity:37/121 - (30%)
Similarity:57/121 - (47%) Gaps:16/121 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PSPRSALGYPFPPMHQNSYSGYHLGSYAP------PCASPPKDDFSISDKCEDSGLRVNGKGKKM 124
            |.|.|:   .|..:|..::..|...||.|      |..|.|:     |:|..::....|...:.:
plant    20 PWPESS---SFNSLHSFNFDPYAGNSYTPGDTQTGPVISVPE-----SEKIMNAYRFPNNNNEMI 76

  Fly   125 RKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYK 180
            :|.|  .:|.||..|.|.||....|....:.:|:..|||...|:.:||||||:::|
plant    77 KKKR--LTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 20/52 (38%)
HB51NP_195999.2 Homeobox 77..130 CDD:395001 21/54 (39%)
HALZ 132..167 CDD:396657
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.