DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and HB16

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 / 830169 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana


Alignment Length:145 Identity:37/145 - (25%)
Similarity:55/145 - (37%) Gaps:55/145 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSAL-GYPFPPMHQNSYSG--YHLGSYAPPCASPP 100
            :.:..|||   |.||                |.| ||.........|||  :|:|          
plant    20 EQSPRGYG---SNYQ----------------SMLEGYDEDATLIEEYSGNHHHMG---------- 55

  Fly   101 KDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQ 165
                 :|:|  ...|:|:                |::.|.:.|:....|....:.:||..|||..
plant    56 -----LSEK--KRRLKVD----------------QVKALEKNFELENKLEPERKTKLAQELGLQP 97

  Fly   166 TQVKIWFQNRRSKYK 180
            .||.:||||||:::|
plant    98 RQVAVWFQNRRARWK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 18/56 (32%)
HB16NP_195716.1 Homeodomain 59..112 CDD:459649 20/70 (29%)
HALZ 114..155 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.