DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and HB40

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001329011.1 Gene:HB40 / 829827 AraportID:AT4G36740 Length:217 Species:Arabidopsis thaliana


Alignment Length:69 Identity:24/69 - (34%)
Similarity:33/69 - (47%) Gaps:8/69 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 DSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRR 176
            |.|   ||..:|.:     .:..|:..|...|.....|....:..|||.|||...||.:||||||
plant    49 DGG---NGLFRKRK-----LTDEQVNMLEMSFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRR 105

  Fly   177 SKYK 180
            :::|
plant   106 ARWK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 19/56 (34%)
HB40NP_001329011.1 HOX 56..109 CDD:197696 19/57 (33%)

Return to query results.
Submit another query.