DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and HAT1

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:135 Identity:39/135 - (28%)
Similarity:56/135 - (41%) Gaps:34/135 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 QDSGFPSPRSALGYPFPPMHQNSYSGYHL-----GSYAPPCASPPKDDFSI----------SDKC 110
            :::|..||.|.:        .::.||...     |:....|.    ||..|          ||:.
plant    73 EETGVSSPNSTI--------SSTVSGKRRSTEREGTSGGGCG----DDLDITLDRSSSRGTSDEE 125

  Fly   111 EDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNR 175
            ||.|      |:..||...: |..|...|...|:....|...::..||..||||..||::|||||
plant   126 EDYG------GETCRKKLRL-SKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNR 183

  Fly   176 RSKYK 180
            |::.|
plant   184 RARTK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 22/56 (39%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:461370 6/32 (19%)
HOX 134..188 CDD:197696 21/54 (39%)
HALZ 190..233 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.